KEGG   Rattus norvegicus (rat): 116506Help
Entry
116506            CDS       T01003                                 

Gene name
Calcr
Definition
(RefSeq) calcitonin receptor
  KO
K04576  calcitonin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116506 (Calcr)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    116506 (Calcr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    116506 (Calcr)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    116506 (Calcr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 116506
NCBI-ProteinID: NP_446268
RGD: 621001
Ensembl: ENSRNOG00000010053
UniProt: P32214 A0A0H2UHI1
Position
4q13
AA seq 533 aa AA seqDB search
MTPRRSRMKRRNLRKPKMRFLLLNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLV
GRKKLLDAQYKCYDRIQQLPPYEGEGPYCNRTWDGWMCWDDTPAGVMSYQHCPDYFPDFD
PTEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTPDKLHNAYVLYYLALVGHSMSIAAL
IASMGIFLFFKNLSCQRVTLHKNMFLTYILNSIIIIIHLVEVVPNGDLVRRDPMHIFHHN
TYMWTMQWELSPPLPLSAHEGKMDPHDSEVISCKILHFFHQYMMACNYFWMLCEGIYLHT
LIVMAVFTEDQRLRWYYLLGWGFPIVPTIIHAITRAVYYNDNCWLSTETHLLYIIHGPVM
AALVVNFFFLLNIVRVLVTKMRQTHEAEAYMYLKAVKATMVLVPLLGIQFVVFPWRPSNK
VLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWAQFKIQWSHRWGRRRRPTNR
VVSAPRAVAFAEPGGLPIYICHQEPRNPPVSNNEGEEGTEMIPMNVIQQDSSA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactccacggagatccagaatgaaaaggcggaacctccgaaaaccgaagatgaggttc
cttctcctgaacaggttcaccctgctgctcctgctcctagtgagccctactccagttctt
caggctcctaccaatctcactgactccggccttgatcaggagccattcctgtacttggtt
ggacgcaagaagcttctggatgctcagtacaagtgctatgaccggattcagcagttgccc
ccttatgagggagaaggtccatattgcaaccgaacttgggatggatggatgtgctgggac
gacactccagctggtgtaatgtcctatcagcactgccctgactactttccggactttgac
ccaacagaaaaggtttcaaaatactgcgatgaaaatggagagtggtttagacaccctgac
agcaaccgaacctggtccaactacactctgtgcaatgccttcactcctgacaaactgcat
aatgcatacgttctttattacctagcacttgtgggccactccatgtcaattgctgctctg
attgcttccatggggatcttcttgtttttcaagaaccttagctgccagagagtgactctg
cacaagaacatgttcctcacttatatcctgaactctatcattatcatcatccacctggtt
gaggttgtgcccaatggagacctggtgcgacgggatcctatgcatatttttcatcataac
acatatatgtggacaatgcagtgggaactgtcaccacccttacccctgagtgcacacgag
ggaaagatggaccctcatgacagtgaagtgataagttgcaagattctgcactttttccat
cagtacatgatggcttgcaactacttctggatgctgtgtgaggggatctatcttcacact
ctgatcgtcatggctgtgttcaccgaggatcaacgtctgcgctggtactatttacttggc
tgggggttcccaatagtgccaactattatccatgccattactcgtgccgtctactacaac
gacaactgttggctgagtacggagacccacttgctttacatcatccatggacccgtcatg
gcggctctggtggtcaacttcttctttctgctcaacattgtccgtgtgcttgtgaccaag
atgaggcaaacccatgaagccgaggcctacatgtacctgaaggctgtaaaggccaccatg
gtccttgtgcccctgctggggatccagtttgttgtgtttccctggaggccctccaacaaa
gtgcttgggaagatctatgattatctcatgcactctctgattcatttccagggattcttt
gtcgcgactatctactgcttctgtaaccatgaggtgcaagtgaccctgaagcgtcagtgg
gcgcagttcaagatccagtggagccatcgctggggtaggcgccgccgccccaccaaccga
gtggttagcgctcctcgtgctgtagcctttgcagaaccaggtggcctccccatttacatc
tgccatcaggaaccaaggaatcctccagtcagcaacaacgaaggcgaagagggtactgaa
atgatccccatgaatgtcatccagcaagactcatccgcttga

DBGET integrated database retrieval system