KEGG   Rattus norvegicus (rat): 116509
Entry
116509            CDS       T01003                                 

Symbol
Slc6a9
Name
(RefSeq) sodium- and chloride-dependent glycine transporter 1
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116509 (Slc6a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116509 (Slc6a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   116509 (Slc6a9)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 116509
NCBI-ProteinID: NP_446270
RGD: 621243
Ensembl: ENSRNOG00000019484
UniProt: P28572
Position
5
AA seq 633 aa
MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRN
GGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIG
IYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASNLTNGSRPTALSGNLSH
LFNYTLQRTSPSEEYWRLYVLKLSDDIGDFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSG
KVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPKWDKILEAKVWGDAASQIFYSLG
CAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVA
DHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWI
LQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGH
RNYFQDIQMMLGFPPPLFFQICWRFVSPTIIFFILIFTVIQYRPITYNHYQYPGWAVAIG
FLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPS
PEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggtaggaaaaggtgccaaagggatgctgaatggtgctgtgcccagcgaggccaccaag
aaggaccagaacctcacacggggcaactggggcaaccagatcgagtttgtactgacgagc
gtgggctatgccgtgggcctgggcaatgtgtggcgtttcccatacctctgctatcgcaac
gggggaggcgccttcatgtttccctacttcatcatgctggtcttctgcggcattcctctc
ttcttcatggagctctccttcggccagtttgcaagccagggctgcctgggggtctggagg
atcagccccatgttcaaaggcgtgggctatggtatgatggtggtgtccacgtacatcggt
atctactacaacgtggtcatctgcatcgccttctactacttcttctcgtccatgacgcat
gtgctgccctgggcttactgcaataatccctggaacacacctgactgtgccggtgtgctg
gatgcttccaatctcaccaatggctcccggcccactgccctgtctggcaacctgtctcac
ctgttcaactacaccttgcaaaggaccagccccagtgaggagtactggaggctgtatgtg
ctgaagctgtcggatgacattggagattttggagaagtgcggcttcctctcctaggctgc
cttggcgtctcctgggtggttgtcttcctctgcctcattcgaggagtcaagtcttcaggg
aaagtggtgtacttcacggccacatttccctatgtggtgctgaccattctgtttgttcgt
ggagtgaccctggaaggagccttcacgggtatcatgtactacctgaccccaaagtgggac
aagatcctggaggccaaggtgtggggggatgcagcctctcagatcttctattccctgggc
tgtgcatggggtggcctcatcaccatggcatcctacaacaaattccacaacaactgctac
cgggacagcgtcatcatcagcatcaccaattgtgctaccagtgtctatgctggcttcgtc
atcttctctatcctaggcttcatggccaatcacctgggtgtggatgtgtctcgggtggca
gaccacgggcccgggctagctttcgtggcttaccccgaggctctcacactgcttcccatc
tccccgctctggtccttgctgtttttcttcatgctcatcctgctgggactcggtactcag
ttctgcctcctggagaccctagtcactgccattgtggatgaggtggggaatgagtggatt
ctgcagaagaagacctacgtgaccttgggtgtggctgtggctggcttcttgctgggtatc
cctcttaccagccaggcgggcatctactggctgctgttgatggacaactacgcagccagc
ttctccttggttgtcatctcctgcatcatgtgcgtgtccatcatgtatatctatgggcac
cggaactacttccaggacattcagatgatgctggggttcccaccgcctctcttcttccag
atctgttggcgttttgtctctcccactatcatctttttcattctcatcttcacggtgatc
cagtaccggccaatcacttacaaccactaccagtacccaggctgggctgtggccatcggc
ttcctcatggctttgtcgtctgtcatctgcatcccattgtacgcattgttccagctctgc
cgcacagatggggacacacttcttcagcgtttgaaaaatgccacaaagccaagcagagac
tggggccctgccctcctggagcaccggactgggcgctatgcccccactacaaccccctct
cctgaagatgggtttgaggttcagccactgcacccggacaaggcccagatccccatcgtg
ggcagtaacggctccagccgcctccaggactcccggatatga

DBGET integrated database retrieval system