KEGG   Rattus norvegicus (rat): 116509
Entry
116509            CDS       T01003                                 

Gene name
Slc6a9
Definition
(RefSeq) sodium- and chloride-dependent glycine transporter 1
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116509 (Slc6a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116509 (Slc6a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   116509 (Slc6a9)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 116509
NCBI-ProteinID: NP_446270
RGD: 621243
Ensembl: ENSRNOG00000019484
UniProt: P28572
Position
5
AA seq 633 aa
MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRN
GGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIG
IYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASNLTNGSRPTALSGNLSH
LFNYTLQRTSPSEEYWRLYVLKLSDDIGDFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSG
KVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPKWDKILEAKVWGDAASQIFYSLG
CAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVA
DHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWI
LQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGH
RNYFQDIQMMLGFPPPLFFQICWRFVSPTIIFFILIFTVIQYRPITYNHYQYPGWAVAIG
FLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPS
PEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggtaggaaaaggtgccaaagggatgctgaatggtgctgtgcccagcgaggccaccaag
aaggaccagaacctcacacggggcaactggggcaaccagatcgagtttgtactgacgagc
gtgggctatgccgtgggcctgggcaatgtgtggcgtttcccatacctctgctatcgcaac
gggggaggcgccttcatgtttccctacttcatcatgctggtcttctgcggcattcctctc
ttcttcatggagctctccttcggccagtttgcaagccagggctgcctgggggtctggagg
atcagccccatgttcaaaggcgtgggctatggtatgatggtggtgtccacgtacatcggt
atctactacaacgtggtcatctgcatcgccttctactacttcttctcgtccatgacgcat
gtgctgccctgggcttactgcaataatccctggaacacacctgactgtgccggtgtgctg
gatgcttccaatctcaccaatggctcccggcccactgccctgtctggcaacctgtctcac
ctgttcaactacaccttgcaaaggaccagccccagtgaggagtactggaggctgtatgtg
ctgaagctgtcggatgacattggagattttggagaagtgcggcttcctctcctaggctgc
cttggcgtctcctgggtggttgtcttcctctgcctcattcgaggagtcaagtcttcaggg
aaagtggtgtacttcacggccacatttccctatgtggtgctgaccattctgtttgttcgt
ggagtgaccctggaaggagccttcacgggtatcatgtactacctgaccccaaagtgggac
aagatcctggaggccaaggtgtggggggatgcagcctctcagatcttctattccctgggc
tgtgcatggggtggcctcatcaccatggcatcctacaacaaattccacaacaactgctac
cgggacagcgtcatcatcagcatcaccaattgtgctaccagtgtctatgctggcttcgtc
atcttctctatcctaggcttcatggccaatcacctgggtgtggatgtgtctcgggtggca
gaccacgggcccgggctagctttcgtggcttaccccgaggctctcacactgcttcccatc
tccccgctctggtccttgctgtttttcttcatgctcatcctgctgggactcggtactcag
ttctgcctcctggagaccctagtcactgccattgtggatgaggtggggaatgagtggatt
ctgcagaagaagacctacgtgaccttgggtgtggctgtggctggcttcttgctgggtatc
cctcttaccagccaggcgggcatctactggctgctgttgatggacaactacgcagccagc
ttctccttggttgtcatctcctgcatcatgtgcgtgtccatcatgtatatctatgggcac
cggaactacttccaggacattcagatgatgctggggttcccaccgcctctcttcttccag
atctgttggcgttttgtctctcccactatcatctttttcattctcatcttcacggtgatc
cagtaccggccaatcacttacaaccactaccagtacccaggctgggctgtggccatcggc
ttcctcatggctttgtcgtctgtcatctgcatcccattgtacgcattgttccagctctgc
cgcacagatggggacacacttcttcagcgtttgaaaaatgccacaaagccaagcagagac
tggggccctgccctcctggagcaccggactgggcgctatgcccccactacaaccccctct
cctgaagatgggtttgaggttcagccactgcacccggacaaggcccagatccccatcgtg
ggcagtaacggctccagccgcctccaggactcccggatatga

KEGG   Rattus norvegicus (rat): 117100
Entry
117100            CDS       T01003                                 

Gene name
Slc6a7
Definition
(RefSeq) sodium-dependent proline transporter
  KO
K05040  solute carrier family 6 (neurotransmitter transporter, L-proline) member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    117100 (Slc6a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117100 (Slc6a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   117100 (Slc6a7)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 117100
NCBI-ProteinID: NP_446448
RGD: 620928
Ensembl: ENSRNOG00000018644
UniProt: P28573 G3V8F1
Position
18
AA seq 637 aa
MKKLQEAHLRKPVTPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALP
LNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAIDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEEESMM
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaagaagctccaggaagctcacctccgcaagcctgtcaccccagacctgctgatgact
cccagtgaccagggtgatgtggacctggatgtagactttgcagcagacagaggcaactgg
acgggcaagctggacttcttgctgtcctgcatcggctactgtgtgggcttgggaaatgtc
tggcggtttccctatcgagcctacaccaatggaggcggagccttcctcgtgccctacttc
ctcatgctggccatctgtggcatccccctcttctttcttgagctctccctgggccagttc
tccagcctgggacccctggctgtctggaaaatcagccccctcttcaaaggtgcgggtgca
gccatgctgctcatcgtgggcctggtggccatctactacaacatgatcatcgcctacgtc
ctcttctacctcttcgcctccctcaccagcaacctgccctgggagcattgcggcaactgg
tggaacacagaacgctgcctggagcacagaggccccaaggatggcaacggggcactgcct
cttaacctcagcagcactgtcagccccagtgaggagtactggagccgatatgtcctgcac
attcagggcagccagggcatcggccgacccggggagattcgctggaacctctgcctctgc
ctgctgctggcctgggtcatcgtgtttctctgtatcctgaagggggtgaagtcctcgggc
aaggtggtgtatttcacagccacctttccctacctcatcctgctcatgctcctggttcga
ggagtgacccttcccggggcctggaagggcatccagttctatctcaccccccaattccac
cacctgctgtcttccaaggtgtggattgaagctgctcttcagatcttctactctctagga
gtgggttttgggggtcttctcacctttgcctcctacaacacattccaccagaacatctac
agagacaccttcattgtcactctgggcaatgccatcaccagcatcctggctggttttgct
atcttctcggtgctgggctacatgtcgcaggagctgggtgtgcctgtggaccaagtggcc
aaagcaggccctggcctggcctttgttgtctacccacaggccatgactatgttgcctctg
tcacccttctggtccttcctcttcttcttcatgcttctgactcttggcctcgatagccag
tttgcctttctggaaaccatagtgactgcagtgaccgatgagttcccatactacctacgg
cccaagaaggcagtgttctcaggcctcatctgtgtagccatgtacctgatgggactgatc
ctcaccaccgatggggggatgtactggctggtccttctggatgactacagcgccagcttc
ggactcatggtggtggtgattaccacatgcctcgctgtcacccgggtatacggcatccag
cggttttgtcgtgacatccacatgatgctgggcttcaagccaggactctacttcagggcc
tgctggctgtttttgtctccggccacactcttggccttgctggtgtacagtatcgtcaag
taccagccctcggaatacggtagctatcgcttccccgcctgggccgagctgctaggcatc
ctgatgggcctgctctcctgcctcatgatcccagctggcatgctggtagctgtgcttcga
gaggagggctcgctctgggagcgacttcagcaagccagccgtcctgctatagactggggc
ccatcactggaagagaaccggacgggcatgtatgtggccaccctggctgggagccagtca
ccaaaaccactgatggtacacatgcgaaaatatgggggcatcaccagcttcgagaataca
gccattgaggtggaccgtgagatcgcagaggaggaagaggagtccatgatgtga

KEGG   Rattus norvegicus (rat): 171148
Entry
171148            CDS       T01003                                 

Gene name
Slc6a5
Definition
(RefSeq) sodium- and chloride-dependent glycine transporter 2
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    171148 (Slc6a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171148 (Slc6a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   171148 (Slc6a5)
SSDB
Motif
Pfam: SNF DUF999
Other DBs
NCBI-GeneID: 171148
NCBI-ProteinID: NP_976079
RGD: 621824
Ensembl: ENSRNOG00000031662
UniProt: P58295
Position
1
AA seq 799 aa
MDCSAPKEMNKPPTNILEATVPGHRDSPRAPRTSPEQDLPAAAPAAAVQPPRVPRSASTG
AQTFQSADARACEAQRPGVGFCKLSSPQAQATSAALRDLSEGHSAQANPPSGAAGAGNAL
HCKIPALRGPEEDENVSVAKGTLEHNNTPPVGWVNMSQSTVVLGTDGIASVLPGSVATTT
IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLA
LAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYL
FASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN
FTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLPFCLFLAWVIVYASLAKGIKTS
GKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSL
SAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENV
ADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYL
RTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL
QRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLG
WLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGERYKNMIDPLG
TSSLGLKLPVKDLELGTQC
NT seq 2400 nt   +upstreamnt  +downstreamnt
atggattgcagtgctcccaaggaaatgaataaaccaccaaccaacatcttggaggcaacg
gtgccgggccaccgggatagccctcgagcacctaggaccagccctgagcaggatcttcct
gcggcagcccccgcggccgctgtccagccgccacgtgtgcccaggtcggcttccaccggc
gcccaaactttccagtctgcggatgcgagagcctgtgaggcacagcggcctggagtaggg
ttttgtaaacttagcagcccccaggcacaagcgacctctgcggccctccgggacttaagc
gaagggcacagcgcacaggccaatcccccttccggggccgctggggctggcaacgcttta
cactgcaagattccagctctgcgtggcccggaggaggacgagaacgtgagtgtggccaag
ggcacgctggagcacaacaataccccacccgtgggctgggtgaatatgagccagagcaca
gtggtgttgggtaccgatggaatcgcgtcggtgctcccgggcagcgtggccaccactacc
attccggaggacgagcaaggggatgagaataaggccagagggaactggtccagcaaactg
gacttcatcctgtccatggtggggtacgcagtggggctgggtaatgtttggaggtttccc
tacctggccttccagaacgggggaggtgctttcctcatcccttacttgatgatgctggca
ctggctggcttacctatcttcttcctagaggtgtccctgggccagtttgccagccagggt
cctgtgtctgtgtggaaggccatcccagctctgcagggctgtggcattgcgatgctcatc
atctccgtcctcatagccatctactacaacgtcatcatctgctacacgctcttctacctg
tttgcttcttttgtgtctgtgctgccctggggatcctgcaacaacccgtggaacacacca
gaatgcaaagacaaaaccaaacttttactagattcctgtgttatcggtgaccatcccaag
atacagatcaagaactctactttctgcatgactgcctatccgaacttgaccatggttaac
ttcaccagccaggccaataagacatttgtcagcgggagtgaagagtacttcaagtacttt
gtgctgaagatttctgcagggattgaatatcctggtgagatcaggtggcccttgccgttc
tgccttttcctggcctgggtgattgtatatgcatcgctggcaaaaggaattaagacatca
ggaaaagtggtgtacttcacagccaccttcccttatgtcgtcctggtcatcctcctcatt
cgaggggtcaccctgcctggagctggagccggtatctggtacttcatcacacctaagtgg
gagaaactcacggatgccacggtgtggaaggatgcagccactcagattttcttctccctg
tctgcggcctggggagggctcatcactctttcttcttacaacaaattccataacaactgc
tacagggacacgttaattgtaacctgcaccaacagtgccactagcatcttcgctgggttt
gtcatcttctctgtcattggcttcatggccaacgagcgcaaagtcaacattgagaatgtg
gctgaccaagggccaggcattgcatttgtggtttacccagaagccttaaccaggctgcct
ctctctccattctgggccatcatctttttcctgatgcttctcacgcttggacttgacacc
atgtttgctaccatcgagaccattgtgacctccatctcggatgagtttcccaagtatctg
cgcacacacaagcctgtgttcaccctgggctgctgcatctgcttcttcattatgggcttc
ccaatgatcacacagggtggaatctacatgtttcagcttgtggacacctatgctgcctcc
tatgctcttgtcatcattgccatatttgagcttgttggcatctcctatgtgtacggcttg
cagaggttctgtgaagacatcgagatgatgattggattccagcccaacattttctggaag
gtctgctgggcgtttgtcacaccgaccattttaacgtttatcctttgcttcagcttctat
cagtgggagcccatgacctatggctcctaccgctaccctaactggtccatggtgcttgga
tggctgatgctcgcctgctccgtgatctggatcccgattatgttcgtgataaaaatgtat
ctggctcctgggagatttattgagaggctgaagttggtatgctcgccacagccggactgg
ggcccattcttagctcagcaccgcggggaacgctacaagaatatgatcgaccccttggga
acctcgtccctgggactcaagctgccagtgaaggatttggaactgggcacccagtgctag

KEGG   Rattus norvegicus (rat): 171163
Entry
171163            CDS       T01003                                 

Gene name
Slc6a13
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 2
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    171163 (Slc6a13)
   04721 Synaptic vesicle cycle
    171163 (Slc6a13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171163 (Slc6a13)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   171163 (Slc6a13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 171163
NCBI-ProteinID: NP_598307
RGD: 620788
Ensembl: ENSRNOG00000012876
UniProt: P31646
Position
4
AA seq 602 aa
MDNRVSGTTSNGETKPVCPVMEKVEEDGTLEREQWTNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRKICPIFEGIGYASQM
IVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCVEFQKTNNSLNVTSENAT
SPVIEFWERRVLKISDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCVALCILNSSTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREILI
LIVSVVSFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGASRFYDNI
EDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSIYKLRTLKGPLRERLRQLVCPAEDLPQKSQPELTSPATPMTSLLRLTELES
NC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggataacagggtctcgggaacgaccagtaatggagagacaaagccagtgtgtccagtc
atggagaaggtggaggaagacggtaccttggaacgggagcaatggaccaacaagatggag
ttcgtactgtcagtggcgggagagatcattggcttaggcaacgtctggaggtttccctat
ctctgctacaagaacgggggaggtgccttctttattccctacctcatcttcctatttacc
tgtggcattcctgtcttcttcctggagacagcgcttggccagtacaccaaccagggaggc
atcacagcctggaggaaaatctgtcccatcttcgagggcatcggctatgcctcacagatg
atcgtcagccttctcaatgtctactacatcgttgtcctggcctgggccctcttctacctc
ttcagcagcttcaccactgacctcccctggggtagctgcagccacgagtggaatacagaa
aactgtgtggagttccagaaaaccaacaattccctgaatgtgacttctgagaatgccaca
tcccctgtcatcgagttctgggagaggcgagtcctgaagatctcagatggcatccagcac
ctggggtccctgcgctgggagctggtcctgtgcctcctgcttgcctggatcatctgctat
ttctgcatctggaaaggggtcaagtccacaggcaaggtggtgtacttcacagctactttc
ccttacctcatgctggtggtcctgttgatccgaggagtaacactgcctggagcagcccag
ggaattcagttttacctgtaccccaacatcacacgtctgtgggatccccaggtgtggatg
gatgcgggcacccagatcttcttctcctttgccatctgcctggggtgcctcacggccctg
ggcagctacaacaagtaccacaacaactgctacagggactgcgtcgccctttgcattctc
aacagcagcaccagcttcgtggccgggtttgccatcttctccatcctgggcttcatgtct
caggagcagggcgtacccatatctgaggttgctgaatcaggccctggcctggcattcatc
gcctaccctcgagctgtggtgatgttacctttctcgcctttgtgggcctgctgtttcttc
ttcatggtggttctcctgggactagacagccagtttgtgtgtgtagaaagcctcgtgaca
gcgctggtggacatgtatccccgggtgttccgtaagaagaaccggagggagattctcatc
ctcatcgtgtctgtcgtctctttcttcatcgggctcattatgctcacagagggcggcatg
tacgtgttccagctcttcgactactatgcggccagtggcatgtgtcttctctttgtggcc
atctttgagtccctctgtgtggcttgggtttacggagccagccgcttctatgacaacatt
gaagatatgattgggtacaagccgtggcctcttatcaaatactgttggctctttttcacg
ccagctgtgtgcctggcaaccttcctgttctccctgatcaaatacacgccactgacctac
aacaagaagtacacatatccatggtggggggatgccctggggtggctcctagctctgtcc
tccatggtctgcattcctgcctggagcatctacaagctcaggactctcaagggcccactc
agagagagacttcgccagctcgtgtgcccggctgaagaccttccccagaagagccaacca
gagctgacttctccagcgacaccgatgacgtccctcctcaggctcacagaactggagtct
aactgctag

KEGG   Rattus norvegicus (rat): 24898
Entry
24898             CDS       T01003                                 

Gene name
Slc6a3
Definition
(RefSeq) sodium-dependent dopamine transporter
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24898 (Slc6a3)
   04721 Synaptic vesicle cycle
    24898 (Slc6a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24898 (Slc6a3)
   05022 Pathways of neurodegeneration - multiple diseases
    24898 (Slc6a3)
  09165 Substance dependence
   05030 Cocaine addiction
    24898 (Slc6a3)
   05031 Amphetamine addiction
    24898 (Slc6a3)
   05034 Alcoholism
    24898 (Slc6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24898 (Slc6a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   24898 (Slc6a3)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 24898
NCBI-ProteinID: NP_036826
RGD: 3715
Ensembl: ENSRNOG00000017302
UniProt: P23977
Position
1
AA seq 619 aa
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgagtaagagcaaatgctccgtgggaccaatgtcttcagtggtggccccggctaaagag
tccaatgctgtgggccccagagaggtggagctcatcctggtcaaggagcagaacggagtg
cagctgaccaactccaccctcatcaacccgccacagacaccagtggaggctcaagagcgg
gagacctggagcaagaaaattgatttcctgctatcagtcatcggctttgctgtggacctg
gccaatgtctggaggtttccctacctgtgctacaaaaatggtggaggtgccttcctggtg
ccctacctgctcttcatggttattgctgggatgcccctcttctacatggagctggctctc
ggacagttcaacagagaaggagctgctggtgtctggaagatctgtcctgtcctgaaaggt
gtgggcttcactgttatcctcatctctttctacgtgggcttcttctacaatgtcatcatc
gcatgggcactgcactacttcttctcctccttcaccatggacctcccatggatccactgc
aacaacacctggaatagccccaactgctccgatgcccatgccagcaactctagcgacggc
ctgggcctcaatgacacctttgggaccacacccgctgctgagtactttgagcgtggcgtg
ctgcaccttcaccagagccgtggcattgatgacctgggccctccacggtggcagctcaca
gcctgcctggtgctggtcattgttctgctctacttcagcctatggaagggagtaaagacc
tcagggaaggtggtgtggatcacagctaccatgccctatgtggtcctcacggccctgctc
ctgcgtggagttacccttcctggagccatggatggcatcagagcatacctcagtgtggac
ttctaccgactctgtgaggcatctgtgtggatcgatgctgccacccaggtgtgcttctcc
ctcggcgttgggtttggagtgctgattgccttctccagttacaataagttcaccaataac
tgctatagagacgcaatcatcaccacctccattaactccctgacaagcttctcctctggc
ttcgtcgtcttctccttcctggggtacatggcacagaagcacaatgtgcccatcagagat
gtggccacagatggacctgggctcatcttcatcatctatcctgaggcgatcgccacactc
ccgctgtcttctgcctgggctgctgtcttcttcctcatgctgctcactctgggtatcgac
agtgcaatggggggcatggagtcagtgatcactgggctcgtcgatgagttccagctgcta
catcggcatcgagagctcttcactcttggcattgtcctggctactttcctgctgtctctc
ttctgcgtcaccaacggtggcatctacgtcttcacactgctggaccactttgcagctggc
acatctatcctctttggcgtgctcattgaagccattggggtggcctggttctacggcgtc
cagcaattcagtgatgacatcaagcaaatgacagggcagcgacccaacctgtactggcgg
ctatgctggaagctggtcagcccctgcttcctcctgtatgtggtcgtggtcagcattgtg
accttcagacccccacactatggggcctacatcttcccagactgggccaatgccctgggc
tggatcatcgccacatcctccatggccatggtgcccatttatgcgacctacaagttctgc
agcctgccggggtccttccgggagaaactggcctatgccatcacacctgagaaagaccat
cagctagtggacagaggggaggtgcgccaattcacgctgcgtcactggctgttgctgtaa

KEGG   Rattus norvegicus (rat): 25550
Entry
25550             CDS       T01003                                 

Gene name
Slc1a1
Definition
(RefSeq) excitatory amino acid transporter 3
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25550 (Slc1a1)
  09156 Nervous system
   04724 Glutamatergic synapse
    25550 (Slc1a1)
   04721 Synaptic vesicle cycle
    25550 (Slc1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25550 (Slc1a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   25550 (Slc1a1)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 25550
NCBI-ProteinID: NP_037164
RGD: 3696
Ensembl: ENSRNOG00000014816
UniProt: P51907
Position
1
AA seq 523 aa
MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIVVGVLVRGHSELSNLDKFYFAFPGEILM
RMLKLVILPLIISSMITGVAALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGV
TQKVNEINRTGKTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPASDPGGNQT
EVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFN
ALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWEIFRKLGLYMATVLSGLAIHSLVVL
PLIYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNHVDKRITRFVLPV
GATINMDGTALYEAVAAVFIAQLNGMDLSIGQIITISITATAASIGAAGVPQAGLVTMVI
VLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQVDVSSEVNI
VNPFALEPTILDNEDSDTKKSYVNGGFSVDKSDTISFTQTSQF
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggggaagcccacgagctcgggatgcgactggcgccgcttcctgcggaatcactggctg
ctgctctccaccgtggccgccgtggtactgggcatcgtggtaggagtcttggttcgagga
cacagtgagctctcgaatctggataaattctactttgcgtttcctggagaaattctgatg
cggatgctgaagctcgtcattctgccactgattatatccagcatgatcacaggtgtcgct
gcactggattccaacgtatctggaaaaattggtcttcgtgctgtagtatattatttctcc
accaccgtcattgctgtaatcctaggtattgtgttagttgtgagcatcaagcctggtgtc
actcagaaagtgaatgaaatcaacaggacaggcaaaacccctgaagtcagcactgtggac
gccatgttggatctgatcaggaacatgttccctgagaacctggtccaagcctgttttcag
cagtacaaaaccaagcgtgaagaagtgaagcctgccagtgatcctggggggaaccagaca
gaggtgtctgtcaccacggccatgacaacaatgtctgagaacaagacaaaggaatacaaa
atcgtgggcctgtactcagacggcatcaacgtcctgggcctgattatcttctgcctcgtc
tttggacttgtcattggaaaaatgggagaaaaagggcagattctggtggatttcttcaat
gcgttgagtgacgccaccatgaaaatcgttcagatcatcatgtgttacatgccgatcggt
attttgttcctaatcgctgggaagatcatagaagttgaagactgggaaatattccgcaag
ttgggcctttatatggccactgtcctgagtgggcttgcaatccactccctcgtagtgctg
ccactgatctatttcatagtcgtgcggaagaaccctttccgctttgccttgggcatggcg
caggctctcctgacagctctcatgatctcatctagctcggcaacccttccagttacattc
cgctgtgcggaagaaaagaaccacgtggacaagaggatcacaagatttgtgctgcccgtc
ggcgccaccatcaacatggacggcactgcgctctatgaagccgtggcagctgtgttcatt
gcgcagctgaacggcatggacctgagcattgggcagatcatcacgatcagcatcacagcc
accgctgctagcattggagctgccggtgtgccccaggctggcctggtgaccatggtgatc
gtgttgagtgccgtggggctgcctgctgaggacgtcaccctcatcattgccgtcgactgg
ctcctggaccggttcaggaccatggtgaacgttctgggtgatgcgtttgggacgggcatc
gtggagaagctgtccaagaaggagctggagcaggtggatgtctcctctgaagtcaacatt
gtgaacccctttgccttggagcccacaatcctggataatgaagactcagatacgaagaag
tcttacgtcaatgggggcttctcggtagacaaatctgacaccatctcgttcactcagacc
tcgcagttctag

KEGG   Rattus norvegicus (rat): 25553
Entry
25553             CDS       T01003                                 

Gene name
Slc6a4
Definition
(RefSeq) sodium-dependent serotonin transporter
  KO
K05037  solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25553 (Slc6a4)
   04721 Synaptic vesicle cycle
    25553 (Slc6a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25553 (Slc6a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   25553 (Slc6a4)
SSDB
Motif
Pfam: SNF 5HT_transport_N
Other DBs
NCBI-GeneID: 25553
NCBI-ProteinID: NP_037166
RGD: 3714
Ensembl: ENSRNOG00000003476
UniProt: P31652
Position
10
AA seq 630 aa
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggagaccacacccttgaattctcagaaagtgctgtcagagtgtaaggacagagaggac
tgtcaagaaaatggtgttctacagaagggtgtccccaccacagcggacagggcagagcct
agccaaatatccaatgggtactctgcagtccccagcacaagtgcaggggacgaagcttca
cactcgatcccagctgccaccaccaccctggtggctgagattcgccaaggggagcgggag
acctggggcaagaagatggatttcctcctgtccgtcattggctatgccgtggacctgggc
aacatctggcggtttccttacatatgctaccagaatggcggaggggccttcctcctccct
tataccatcatggccattttcggggggatcccgctcttttacatggagctcgcactgggc
cagtaccaccgaaacgggtgcatttccatatggaggaagatctgcccgattttcaaaggc
attggttacgccatctgcatcatcgccttttacatcgcctcctactacaacaccatcata
gcctgggcgctctactacctcatctcctccctcacggaccggctgccctggactagctgc
acgaactcctggaacactggcaactgcaccaactacttcgcccaggacaacatcacctgg
acgctgcattccacgtcccccgctgaggagttctacttgcgccatgtcctgcagatccac
cagtctaagggactccaggacctgggcaccatcagctggcagctgactctctgcatcgtg
ctcatcttcaccgtaatctactttagcatctggaaaggcgtcaaaacatctggcaaggtg
gtgtgggtgacagccaccttcccatacattgtcctctctgtcctgctggtgaggggggcc
acccttcctggagcctggagaggggtcgtcttctacttgaaacccaactggcagaaactc
ttggagacaggggtgtgggtagatgccgccgctcagatcttcttctctcttggcccgggc
tttggggttctcctggcttttgctagctacaacaagttcaacaacaactgttaccaagat
gccctggtgaccagtgtggtgaactgcatgacaagcttcgtctctggcttcgtcatcttc
acggtgcttggctacatggcggagatgaggaatgaagatgtgtcagaggtggccaaagac
gcaggccccagcctcctcttcatcacgtatgcagaggcaatagccaacatgccagcatcc
acgttctttgccatcatcttcttcctcatgttaatcacgctgggattggacagcacgttc
gcaggcctggaaggtgtgatcacagctgtgctggatgagttccctcacatctgggccaag
cgcagggaatggttcgtgctcatcgtggtcatcacgtgcgtcttgggatccctgctcaca
ctgacgtcaggaggggcatacgtggtgactctgctggaggagtatgccacggggccagca
gtgctcaccgtggccctcatcgaggccgtcgccgtgtcttggttctatggaatcactcag
ttctgcagcgatgtgaaggagatgctgggcttcagcccgggatggttttggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagccca
ccccagctacggcttttccaatacaactatccccactggagtatcgtcttgggctactgc
atagggatgtcgtccgtcatctgcatccctacctatatcatttatcggctgatcagcact
ccggggacacttaaggagcgcattattaaaagtatcactcctgaaacacccacagaaatc
ccgtgtggggacatccgcatgaatgctgtgtaa

KEGG   Rattus norvegicus (rat): 29482
Entry
29482             CDS       T01003                                 

Gene name
Slc1a2
Definition
(RefSeq) excitatory amino acid transporter 2 isoform a
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29482 (Slc1a2)
   04721 Synaptic vesicle cycle
    29482 (Slc1a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29482 (Slc1a2)
   05016 Huntington disease
    29482 (Slc1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29482 (Slc1a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   29482 (Slc1a2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 29482
NCBI-ProteinID: NP_058911
RGD: 3697
Ensembl: ENSRNOG00000005479
UniProt: P31596 Q8K5B5
Position
3
AA seq 573 aa
MASTEGANNMPKQVEVRMHDSHLSSEEPKHRNLGMRMCDKLGKNLLLSLTVFGVILGAVC
GGLLRLAAPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPSEEANTTKAVISLLNETMNEAPEETKIVIKKGLEFKDGMN
VLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKII
AIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGT
ASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILD
GGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSV
NVVGDSFGAGIVYHLSKSELDTIDSQHRMHEDIEMTKTQSIYDDTKNHRESNSNQCVYAA
HNSVVIDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcatcaaccgagggtgccaacaatatgcccaagcaggtggaagtgcgcatgcacgac
agccacctcagctccgaggagccaaagcaccgaaacctgggcatgcgcatgtgcgacaag
ctggggaagaacctcctgctctcactgactgtgtttggtgtcatcctgggagcagtatgt
ggcgggctgcttcgcttggcggctcccatccaccctgatgtggtcatgttgatagccttc
ccgggggacatcctcatgaggatgctgaagatgctcatcctccctctcatcatttccagt
ctcatcacagggctgtcagggctggatgctaaagccagcggccgcctaggcacgagagcc
atggtatattacatgtccacgaccatcattgccgctgtgctgggggtcatcctggtgttg
gccatccaccctgggaatcccaaactcaagaagcagctggggcctgggaagaagaacgac
gaggtgtccagcctggatgccttcctggatctcattagaaatctcttcccggagaacctg
gtacaagcctgtttccaacagattcagactgtgacaaagaaagttctggtggcacctcca
tccgaggaggccaatacaaccaaggcagtcatctccctgttgaatgagaccatgaatgag
gcccctgaagaaactaagatcgttatcaagaagggcctggagttcaaggacgggatgaat
gtcttaggtctgattggattctttattgctttcggcattgccatggggaagatgggtgag
caggccaagctgatggtggagttcttcaacattctgaacgagattgtcatgaagttagtg
atcatgatcatgtggtattccccgctgggtatcgcctgcttgatctgtgggaagatcatc
gccatcaaggacttagaagtggttgctaggcagctggggatgtacatgatcacagtgatc
gtgggcctcatcattcatgggggcatctttctccccttgatttactttgtagtgaccaga
aaaaacccattctccttttttgctggcattttccaagcctggatcactgccctgggaacc
gcttccagtgctggaactttgcctgtcaccttccgttgcttggaagataatctagggatt
gacaagcgtgtgaccagattcgtcctcccagtcggagcaaccattaacatggatggtaca
gccctttacgaagccgtggcagccatcttcatagcccagatgaatggggtcatcctggat
ggaggtcagatagtgactgtaagccttacagcaactctggcgagcattggtgcagccagt
attcccagcgccgggttggtcaccatgctcctcattctcacagctgtgggcctgccgaca
gaggacatcagtctgctggtggcagtggactggctgctggatagaatgagaacttcggtc
aatgtagtgggcgattcttttggggctgggattgtctatcacctttccaagtccgagctg
gacaccattgactcccaacaccgaatgcacgaagacatcgaaatgaccaagacgcagtcc
atttatgacgacacgaagaaccacagggaaagcaactctaatcagtgtgtctatgccgca
cacaactctgtcgtaatagatgagtgcaaggtaactctggcggccaatggaaagtcagct
gactgcagtgttgaggaagaaccttggaaacgtgaaaaataa

KEGG   Rattus norvegicus (rat): 29483
Entry
29483             CDS       T01003                                 

Gene name
Slc1a3
Definition
(RefSeq) excitatory amino acid transporter 1 isoform 1
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29483 (Slc1a3)
   04721 Synaptic vesicle cycle
    29483 (Slc1a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29483 (Slc1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29483 (Slc1a3)
   04147 Exosome [BR:rno04147]
    29483 (Slc1a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   29483 (Slc1a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   29483 (Slc1a3)
SSDB
Motif
Pfam: SDF Yip1 MT
Other DBs
NCBI-GeneID: 29483
NCBI-ProteinID: NP_062098
RGD: 3698
Ensembl: ENSRNOG00000016163
UniProt: P24942 G3V846
Position
2
AA seq 543 aa
MTKSNGEEPRMGSRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVSAVIV
GTILGFALRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTSYEKRSFKVPIQANETLLGAVINNVSEAMETLTRIREEMVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFD
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNEPEKPVADSE
TKM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgacaaaaagcaacggagaagagcccaggatgggaagcaggatggaaagattccagcaa
ggggtgcgcaagcggacgctcctggccaagaagaaagttcagaacatcaccaaggaggat
gtgaagagctacctgtttcggaatgcctttgtgctactcaccgtcagcgctgtcattgtg
ggtacaatccttggatttgccctccgaccgtataaaatgagctaccgggaggtcaagtac
ttctcctttcctggggagcttctgatgcggatgctgcagatgttggtcttacccctgatc
atctccagtcttgtcacaggaatggcggccctagatagtaaggcatctgggaagatgggg
atgcgagctgtggtctattacatgactaccaccatcattgctgtggtgatcggcataatc
attgtcatcatcatccaccccggaaagggcacgaaagaaaacatgtacagagaaggtaaa
atcgtgcaggtgactgccgcagatgccttcctggatttaatcaggaacatgttcccaccc
aatctggtagaagcctgctttaaacagtttaaaaccagctatgagaagagaagctttaaa
gtgcccatccaggccaacgaaacactgttgggcgccgtgatcaacaacgtgtcagaggcc
atggagactctgacccggatccgggaggagatggtacccgttcctgggtctgtgaatggg
gtcaatgccctgggcctcgttgtcttctccatgtgcttcggcttcgtgatcggaaacatg
aaggagcaggggcaagcgctaagagagttcttcgactctctcaatgaagccatcatgaga
ttggtagcggtgataatgtggtatgcacctctgggcatcctcttcttgatcgcagggaag
attgttgagatggaagatatgggtgtgattggggggcagcttgccatgtatacagtgaca
gtcatcgtcggcctcctcattcatgccgtcatcgtcctgcctctcctctacttcctggta
acccggaagaacccctgggttttcattggagggttgctgcaagcactcatcacagccctg
gggacctcctcaagttctgccaccctgcccatcactttcaagtgcctggaagaaaacaat
ggtgtggacaaacgcatcaccagatttgtgcttcccgtgggggccaccattaacatggat
gggaccgccctctacgaggctttggccgccattttcatcgctcaagttaacaactttgac
ctgaattttggacagattataacaataagtatcacagccacagccgcaagcattggggca
gctggcattcctcaggccggtctagtcaccatggtcatcgtgctgacatctgtgggcctg
cccacggatgacatcacactcatcattgcagtggactggtttctggaccgcctccgaacc
accaccaacgtgctgggtgactccctcggggccgggattgttgaacacttgtcccgacat
gaactgaagaaccgagatgttgaaatggggaactccgtgattgaggagaatgaaatgaaa
aagccgtatcagctgattgcccaggacaatgaaccagagaaacccgtggcagacagcgaa
accaagatgtag

KEGG   Rattus norvegicus (rat): 366432
Entry
366432            CDS       T01003                                 

Gene name
Slc1a7
Definition
(RefSeq) excitatory amino acid transporter 5
  KO
K05618  solute carrier family 1 (glutamate transporter), member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    366432 (Slc1a7)
   04721 Synaptic vesicle cycle
    366432 (Slc1a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    366432 (Slc1a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   366432 (Slc1a7)
SSDB
Motif
Pfam: SDF DUF2417
Other DBs
NCBI-GeneID: 366432
NCBI-ProteinID: NP_001102443
RGD: 1311928
Ensembl: ENSRNOG00000011644
UniProt: D3ZT83
Position
5
AA seq 570 aa
MEWCQQAGLSMVLGAFLARGRAVCRHNGLLILSVLSVIVGCLLGFFLRTQRLSPQEISYF
QFPGELLMRMLKMLILPLVVSSLMSGLASLDAKTSSRLGILTVAYYLWTTFLAVVVGIIM
VSIIHPGGAAQKETTEQSGKPVMSSADALLDLVRNMFPANLVEATFKQYRTKTTPVIKSP
KGAAEEAPPRGIVIYGVQEDNGSRVQNFALDLTPPPEIVYKSEPGTSDGMNVLGIVIFSA
TMGIMLGRMGDSGTPLVSFCQCLNESVMKIVAVAGWYFPFGIVFLIAGKILEMDDPKAVG
KKLGFYAVTVVCGLVVHGLLILPLLYFLITRKNPIVFIRGVLQALLIALATSSSSATLPI
TFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISI
TATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDINLIIAVDWALDRFRTMINVLGDALAA
GIMAHICRKDFAQDMGTEKLLPCETKPVTLQEIVAAQQNGCVKSVAEASELTLGPKCPHH
IPVQVEQDEELATASLDHCTIEINELETNV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggaatggtgccaacaggctgggctcagcatggtgctgggcgcctttctggctcgaggg
cgggcagtgtgtagacacaacgggctcctcatcctgtctgtgctgtctgtcatcgtgggc
tgcctccttggcttcttcctcaggacccagcgcctctcaccacaggagattagctacttc
cagttccctggagaactcttgatgaggatgctgaagatgctgatcctaccactggtggtc
tccagcttgatgtctggccttgcctccctggatgccaagacctccagccgcttgggcatc
ctcaccgtggcatattacctgtggaccacctttctggctgtcgtcgtgggcatcatcatg
gtctccatcatccaccctggtggtgcagcacagaaggagaccaccgaacagagtggaaag
ccagtcatgagctcagccgatgccctcctggaccttgtccggaacatgtttccagccaac
ctggtagaagccacattcaaacagtaccgcaccaaaaccaccccagttatcaagtctccc
aaaggggctgcggaggaggcccctccccgggggatcgtcatctacggggtccaggaagac
aacggctcacgtgtgcagaactttgccctggacctgacgcccccgcctgagattgtctat
aagtcagagcctggtacgagtgacggcatgaacgtgctaggcatcgtcatcttctcggcc
actatgggcatcatgctgggccgcatgggtgacagcgggacccccctggtcagcttctgt
cagtgccttaatgagtccgtcatgaagatcgtggcagtggcagggtggtacttccccttc
ggcattgtcttcctgatcgctggcaagatcctggagatggatgaccccaaggctgtgggg
aagaagctgggcttctatgccgtgaccgtggtttgtgggctggtggtccacggtctccta
atcctgcccctgctgtatttcctcatcaccaggaagaaccccatcgtcttcatccgtggc
gtcctccaagctctgctcattgcactggccacctcctccagctcagccaccctgcccatc
accttcaagtgtctgctggagaacaaccacatcgaccgacgcatcgctcgctttgtgctg
cccgtgggcgccaccatcaacatggacggcactgcgctctacgaggctgtggctgccatc
tttattgcccaggtcaacaactacgagctagactttggccagatcatcactatcagcatt
acagccactgcagccagcattggggcggctggcatcccgcaggcagggctcgtcaccatg
gtcattgtgctcacctctgtgggactgccgaccgatgacatcaacctcatcatcgctgta
gactgggcactggatcgcttccgaaccatgattaacgtgctgggcgatgcgctggcagca
gggatcatggcccacatctgccggaaggattttgctcaggacatgggcactgagaaattg
ctgccctgtgaaaccaagccagtgacactgcaggagatcgtggctgcccagcagaacggc
tgtgtgaagagtgtggctgaggcctcagagctaaccctgggccccaagtgtccacaccac
atcccggtccaggtagagcaggatgaagagctggccactgccagcctagaccactgcact
atcgagatcaatgagctggagaccaatgtgtga

KEGG   Rattus norvegicus (rat): 50676
Entry
50676             CDS       T01003                                 

Gene name
Slc6a12
Definition
(RefSeq) sodium- and chloride-dependent betaine transporter
  KO
K05045  solute carrier family 6 (neurotransmitter transporter, betaine/GABA) member 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    50676 (Slc6a12)
   04721 Synaptic vesicle cycle
    50676 (Slc6a12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    50676 (Slc6a12)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   50676 (Slc6a12)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 50676
NCBI-ProteinID: NP_059031
RGD: 620255
Ensembl: ENSRNOG00000013547
UniProt: P48056 A0A0G2JSN3
Position
4
AA seq 628 aa
MSSGAWEERVSLSSMDRKVTVHEDGCPVVSWVPEEGEMMDQKDKDQVKDRGQWTNKMEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFSCGIPVFFLEVALGQYSSQGSVT
AWRKICPLLQGIGMASVVIESYLNIYYIIILAWALFYLFSSFTWELPWTTCTNSWNTEHC
VDFLNYSSTRAASYSENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWIICYF
CIWKGVKSTGKVVYFTATFPYLMLIILLIRGVTLPGAYQGIVFYLKPDLLRLKDPQVWMD
AGTQIFFSFAICQGCLTALGSYNKYHNNCYRDSIALCFLNSATSFVAGFVVFSILGFMAQ
EQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFLMLLFLGLDSQFVCMECLVTA
SMDMFPQQLRKRGRRELLILAVAIVCYLMGLLLVTEGGMYIFQLFDYYASSGICLLFLSL
FEVICIGWVYGADRFYDNVEDMIGYRPWPLVKISWLFLTPGLCLATFFFSLSKYTPLKYN
NVYIYPSWGYSIGWLLAFSSMACVPLFIIITLLKTQGSFKKRLQRLITPDPSLPQPGRRS
PQDGSSAQNCSTSPVKQELIAWEKETHL
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgtcatcgggagcttgggaagaaagggtctccctctccagtatggacagaaaggttaca
gtccatgaagatgggtgtcctgtggtctcttgggtccctgaggagggagagatgatggac
cagaaagacaaggaccaggtgaaggatcgaggccaatggaccaacaagatggagttcgta
ctgtcagtggcgggagagatcattggcttaggcaacgtctggaggtttccctatctctgc
tacaagaacgggggaggagccttcttcatcccctacttcatcttcttcttcagctgtggt
atcccagtgttcttcctggaggtggcactgggtcagtatagcagccaggggagtgttact
gcttggaggaagatctgtccccttctccaaggcattggcatggcatctgtggtcatcgag
tcttatttgaacatctactacatcatcatccttgcctgggctctcttctacctgttcagc
tccttcacctgggagcttccctggacaacctgcaccaactcctggaacacagaacattgc
gtggactttctgaactactcatcgaccagagccgcaagctactctgagaacttcacctca
ccagtcatggaattctgggagagacgggttttgggtattacatcaggcatccatgacctg
gggtccctgcgctgggagctggccctgtgcctcctgctcgcctggatcatctgctacttc
tgcatctggaagggagtcaagtccacgggcaaggttgtttacttcacagccacttttccc
tacctgatgctgattattcttctgatccggggtgttacccttcctggagcctaccagggc
atcgtcttctacctgaagccagacttgctccgcctcaaggacccccaggtgtggatggat
gcgggcacccagatcttcttttcctttgccatctgccaggggtgcctcacggccctgggc
agctacaacaagtaccacaacaactgctacagggactccatcgccctctgcttcctgaac
agtgccaccagcttcgtggctggttttgttgtcttctccatcctgggcttcatggctcag
gagcagggcgtgcccatttctgaagtggctgagtcaggtcctggactggctttcattgcc
ttccccaaagcagtgacgatgatgcctttgtcccagctgtggtcctgcctcttcttcctc
atgctcctatttctagggctggacagccagttcgtctgtatggagtgcctggtcactgct
tccatggatatgtttcctcagcagctccgaaagagaggccggcgcgagctgctgatcctc
gcagttgctatcgtgtgctacttgatggggctccttctggtcactgagggtgggatgtac
attttccagctctttgactactacgcctccagcggaatatgcctactcttcctctccttg
tttgaggtcatctgcattggctgggtgtacggggcggatcgtttctatgacaacgtggag
gacatgattggctatcggccatggcccttggtgaagatctcttggctcttcctgacccct
ggtctttgcctggccaccttcttcttctccttgagcaagtatacacctctcaaatacaac
aatgtctacatatacccttcttggggatactccattggatggctcttggctttttcctcc
atggcctgtgtaccgctctttattatcatcaccctcctgaagacccagggctccttcaag
aagcgccttcaaagactcatcacgccagatcccagtctgccccagccagggaggcgttca
cctcaggatggctcctctgctcaaaactgttcgacctctccagtcaagcaagaactcatt
gcctgggagaaggagacgcatttgtag

KEGG   Rattus norvegicus (rat): 79212
Entry
79212             CDS       T01003                                 

Gene name
Slc6a1
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 1
  KO
K05034  solute carrier family 6 (neurotransmitter transporter, GABA) member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    79212 (Slc6a1)
   04721 Synaptic vesicle cycle
    79212 (Slc6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    79212 (Slc6a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   79212 (Slc6a1)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 79212
NCBI-ProteinID: NP_077347
RGD: 620533
Ensembl: ENSRNOG00000006527
UniProt: P23978
Position
4
AA seq 599 aa
MATDNSKVADGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGY
AIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAP
MFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLV
NTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVV
YFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
GSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASG
PGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRR
ELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRF
YDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPLTMGSYVFPKWGQGVGWLM
ALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQAGSSASKEAYI
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgactgacaacagcaaggtggctgatgggcagatctctaccgaggtcagcgaggct
cctgtggccagtgacaagcccaaaacccttgtagtcaaggtgcagaagaaggctggagac
ctccctgaccgggacacatggaagggacgcttcgacttcctcatgtcctgtgtgggctac
gccatcggcctgggcaatgtatggaggttcccttatctctgcggaaagaacggtggtggg
gccttcctaattccatatttcctgacgctcatctttgcgggtgttcctctcttccttttg
gagtgctccctaggccagtacacctccattgggggcctgggcgtatggaagctggctccc
atgttcaagggtgtgggcctcgcggcagctgtgctgtccttctggctgaacatttattac
attgtcatcatctcctgggccatctactacctgtacaactccttcaccacgactctgccg
tggaaacagtgtgacaacccctggaacactgaccgctgcttctccaactatagcctggtc
aacaccaccaacatgaccagtgccgtggtggaattctgggagcgcaacatgcaccaaatg
acagatgggctagacaagccaggacagatccgctggccgctagccatcacactggccatt
gcctgggtgcttgtgtatttctgcatctggaagggtgttggatggactggaaaggtggtc
tacttctcagccacatacccctacatcatgctcatcatcctgttcttccgtggagtgaca
cttcctggggccaaggaggggatcctcttctacatcacgcccaacttccgaaagctgtct
gattctgaggtgtggcttgacgccgccacccagatcttcttctcctacggactgggcctg
gggtccctgattgctctgggaagctacaactctttccacaacaatgtgtacagggactcc
atcattgtttgctgcatcaactcctgcaccagcatgtttgccggcttcgtcatcttctcc
atcgtgggcttcatggctcatgtcaccaagaggtccatagccgatgtggcggcctcaggc
cctggactggcattcttggcgtaccccgaggctgtgacacagctacccatctctcccctc
tgggctatcctcttcttctccatgctgctgatgctgggcattgacagccagttctgtacc
gtggagggcttcatcactgccctggtggatgagtaccccaggcttctccgcaatcgccgt
gaactcttcattgctgccgtgtgcatcgtgtcctacctgattggcctctctaacatcacc
cagggtggcatttatgtcttcaaactgttcgattattactctgccagtggcatgagcctg
ctgttcctggttttctttgagtgtgtctccatttcctggttttatggtgtcaaccggttc
tatgacaacatccaggagatggttggctccaggccctgcatctggtggaagctgtgctgg
tcctttttcacacccatcattgtggcgggcgtgtttctcttcagtgctgtgcagatgaca
ccactcaccatgggaagctacgttttccccaagtggggccagggcgtgggctggctcatg
gctctgtcctccatggtgctcatccccgggtacatggcttacatgttcctcaccctaaag
ggctctctgaagcagcgtctccaggtcatgattcagcccagtgaagatatcgtgcgccct
gagaatggtcctgagcagccgcaggctggcagctcagccagcaaggaggcctacatctag

KEGG   Rattus norvegicus (rat): 79213
Entry
79213             CDS       T01003                                 

Gene name
Slc6a11
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 3
  KO
K05044  solute carrier family 6 (neurotransmitter transporter, GABA) member 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    79213 (Slc6a11)
   04721 Synaptic vesicle cycle
    79213 (Slc6a11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    79213 (Slc6a11)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   79213 (Slc6a11)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 79213
NCBI-ProteinID: NP_077348
RGD: 628737
Ensembl: ENSRNOG00000005697
UniProt: P31647
Position
4
AA seq 627 aa
MTAEQALPLGNGKAAEEARGSEALGGGGGGAAGTREARDKAVHERGHWNNKVEFVLSVAG
EIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRRV
CPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTEKCVEFQK
LNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWK
GTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQ
IFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGV
PIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDM
YPKVFRRGYRRELLILALSIVSYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECV
CIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNVYT
YPAWGYGIGWLMALSSMLCIPLWIFIKLWKTEGTLPEKLQKLTVPSADLKMRGKLGASPR
MVTVNDCEAKVKGDGTISAITEKETHF
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgactgcggagcaagcgctgcccctgggcaacgggaaggcggccgaggaggcgcgaggg
tccgaggcgctgggcggcggcggcgggggcgcggcggggacgcgcgaggcgcgcgacaag
gcggtccacgagcgcggtcactggaacaacaaggtggagttcgtgttgagcgtagcggga
gagatcatcggtctgggcaacgtgtggcgcttcccctacctgtgctacaagaacggcgga
ggggcattcctgattccttacgtggtgtttttcatctgctgtggaatccccgtcttcttc
ctggaaacggctctggggcagttcacgagcgagggcggcatcacgtgctggaggagagtc
tgtcctttatttgaaggcatcggctatgcaacacaggtgatcgaggcgcatctcaatgtc
tactacatcatcatcctggcgtgggccatcttctacttaagcaactgcttcaccaccgag
ctcccctgggccacctgtgggcatgagtggaacacagagaaatgtgtggagttccagaag
ctgaacttcagcaactacagtcatgtgtccctgcagaacgcaacctccccggtcatggag
ttctgggaacgccgggtcttggctatatctgatggcattgaacacatcgggaacctccga
tgggagctggcactgtgtctcctggcggcttggaccatctgctacttctgcatctggaag
ggtacgaagtcaactggaaaggtcgtgtatgtcactgcaaccttcccctacatcatgctg
ctgatcctcctgatccgaggggtcacgttgccgggtgcctcggaaggcatcaagttctac
ctgtaccctgacctctcccggctctctgatccacaggtgtgggtggatgctgggacgcag
atctttttctcctatgccatctgcctgggctgcctgaccgctctggggagttacaacaac
tataacaacaactgctacagggactgtattatgctctgctgtctgaacagtggcaccagc
ttcgtggctgggtttgctatcttctcagtcctgggcttcatggcgtacgagcagggcgtg
cctattgctgaggtggcagaatcaggtcctggactggctttcatcgcctaccccaaggct
gtcactatgatgcccctgtccccattgtgggccaccctgttcttcatgatgctcatcttc
ctgggcctggacagtcagtttgtgtgtgtggagagccttgtgacagccgtggttgacatg
taccccaaggtcttccggcggggctaccggcgagaactgctcatcctggccctgtccatt
gtctcttatttcctaggcctggtgatgctgacagagggaggcatgtacattttccagctt
tttgactcatacgccgccagtggcatgtgcttgctcttcgtggccatctttgagtgtgtc
tgcatcggctgggtgtatggaagtaacaggttctatgacaatattgaggacatgattgga
taccggccactgtcactcatcaagtggtgctggaaagttgtgacccctgggatctgtgcg
ggcatcttcatcttctttctggtcaagtacaagccgctcaagtacaacaatgtgtacaca
tatcctgcttggggctacggcattggctggctcatggctctgtcctccatgctgtgcatc
ccgctctggatcttcatcaagctgtggaagacagagggcaccctgcccgagaaattacag
aagttgacagtccccagcgctgatctgaaaatgaggggcaagcttggggccagcccacgg
atggtgaccgttaatgactgtgaggccaaggtcaaaggcgacggtaccatctctgccatc
acagagaaggagacgcacttctga

KEGG   Rattus norvegicus (rat): 83511
Entry
83511             CDS       T01003                                 

Gene name
Slc6a2
Definition
(RefSeq) sodium-dependent noradrenaline transporter
  KO
K05035  solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    83511 (Slc6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83511 (Slc6a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   83511 (Slc6a2)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 83511
NCBI-ProteinID: NP_112633
RGD: 621822
Ensembl: ENSRNOG00000016311
UniProt: Q9WTR4
Position
19
AA seq 617 aa
MLLARMKPQVQPELGGADQLPEQPLRPCKTADLLVVKEHNGVQCLLASQDGDAQPRETWG
KKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQFN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHAW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgcttctggcacgaatgaagccgcaggtgcagcctgagctcggcggggcggaccagctg
cccgagcagcccctgaggccctgcaaaaccgccgatctgctagtggtgaaggagcacaac
ggcgtccagtgtctcctggcatcccaggatggtgacgcgcagccccgggagacttggggc
aagaagattgatttcctgctgtctgtggtgggcttcgcagtggacctggccaatgtgtgg
cgcttcccctatctctgctacaagaatggtggtggtgccttcctgattccatatacactg
ttcctcatcattgctgggatgcctctgttttacatggagctggctctggggcagttcaac
cgggagggggcagccacagtgtggaagatctgccctttcttcaaaggagtgggctatgct
gtgatcctcattgccctctatgttggcttttactacaatgtcatcattgcctggtcactg
tactacctcttcgcgtccttcaccttgaacctgccctggaccaactgtggccatgcctgg
aacagccccaactgtaccgaccccaaactcctcaacgcctcggtgctgggcgaccatacc
aaatactccaaatacaagttcacaccggctgcagagttttatgagcgtggtgtcctacac
cttcacgagagcagtgggatccatgacatcggcctgccccagtggcagctgttgctatgc
ctgatggtcgttatcgttgtcctgtatttcagcctctggaaaggagtgaagacatcggga
aaggttgtctggatcacagccaccctgccttactttgtcctctttgtgctcctggttcat
ggcgtcactctgcctggtgcttccaatggcatcaacgcctacctgcacattgacttctac
cgcctcaaggaggccacggtatggatcgatgctgcaacccaaatattcttttccctggga
gctggatttggagtcttgattgcatttgccagttacaataaatttgacaacaactgttac
agggatgccttgctgaccagcaccatcaactgtgttaccagttttatttctggatttgcc
attttctccatccttggttacatggcccatgaacataaagtcaagattgaggatgtcgcc
actgaaggagctggccttgtatttgtcctgtatccagaagccatttctactctgtcggga
tccacgttctgggctgtcctgttcttcctgatgctcctggctctggggctagatagctca
atgggaggcatggaggcagtcatcaccggactggctgatgacttccaggtcctgaagcga
caccgaaaactcttcacatgtgctgtcaccctcggtacctttcttctggccatgttttgc
ataacgaagggagggatttacgtgctcactctgctggacaccttcgcggcaggcacgtcc
attctctttgccgtgctcatggaggccattggagtttcctggttttatggcgtggacagg
ttcagcaatgacatccagcagatgatggggtttaagccaggcctgtactggagactgtgt
tggaagttcgtgagccccgccttcctcctgtttgtggtagtggtcagcatcatcaacttc
aagccactcacctatgatgactacgtctatcctccttgggccaactgggtcgggtggggc
attgccctctcatccatgatcctggtacctgcctacgtcatctacaaattcttcagcata
cggggctccctttgggagagagtggcctacggaatcaccccggagaatgagcaccacctg
gtggcccagagagacgtgagacagttccagttgcggcactggctggctatttga

KEGG   Rattus norvegicus (rat): 84012
Entry
84012             CDS       T01003                                 

Gene name
Slc1a6
Definition
(RefSeq) excitatory amino acid transporter 4
  KO
K05617  solute carrier family 1 (high affinity glutamate/aspartate transporter), member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    84012 (Slc1a6)
   04721 Synaptic vesicle cycle
    84012 (Slc1a6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    84012 (Slc1a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84012 (Slc1a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   84012 (Slc1a6)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 84012
NCBI-ProteinID: NP_114454
RGD: 620340
Ensembl: ENSRNOG00000007509
UniProt: O35921 Q7TSX6
Position
7
AA seq 561 aa
MSSHGNSLFLRESGAGGGCLQGLQDSLQQRALRTRLRLQTMTREHVRRFLRRNAFILLTV
SAVIIGVSLAFALRPYQLSYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLDNKA
TGRMGMRAAVYYMVTTVIAVFIGILMVTIIHPGKGSKEGLHREGRIETVPTADAFMDLVR
NMFPPNLVEACFKQFKTQYSTRVVTRTIVRTDNGSELGASISPPSSAENETSILENVTRA
LGTLQEVISFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLNEAI
MRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGGVLPLIYF
LVTHRNPFPFIGGILQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGATVN
MDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVLTSV
GLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPY
KSLMAQEKGASRGRGGNESVM
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgagcagccacggcaacagtctgttcctgagggagagcggcgctggcgggggctgtctg
caaggcctgcaggacagtctgcagcagagagcactgcgcacgcgcttgcgcctgcagacc
atgacccgagagcacgtgcggcgcttcctgcgccgaaatgccttcatcttgctcacagtc
agcgctgtgatcattggcgtcagcctggcatttgccttgcgcccataccagctctcctac
cgccagatcaagtacttctcttttcctggtgagctgctcatgaggatgctgcagatgctg
gtgctacccctcattgtctccagccttgtcacaggtatggcatccttggacaacaaggca
acagggaggatgggaatgagggcagctgtgtactacatggtgacgaccgtcattgcagtt
ttcatcggcatcctaatggttaccatcatacatcctgggaagggctccaaggaggggctg
caccgtgagggccgaattgagactgttccaacagctgatgctttcatggacctggtcaga
aatatgtttccaccaaaccttgtggaggcctgcttcaaacagtttaaaacacagtacagc
acacgagtggtaacaaggacgattgtaaggacagacaacgggtcagagttgggggcctcc
atttctcctccatcctcagcagaaaatgaaaccagcatcctggaaaatgtcacccgggcc
ttgggcaccctgcaggaggtgataagctttgaggagactgtgcctgtacctggctcagct
aatggcatcaacgctttgggcctcgtggtcttctctgtggccttcgggctggtcatcggt
ggcatgaagcacaaaggccgtgtcctgagggatttcttcgacagcctcaatgaggctatt
atgaggctggtgggcatcatcatctggtatgcaccagtgggcatcctgttcctgattgct
ggaaagattctggaaatggaagacatggctgtccttggaggtcagctgggcatgtacacg
ctgactgtcattgtcggcttatttcttcatgctggtggtgtgttacccctcatctacttc
cttgtcacacatcggaacccctttcccttcatcggtggtatactacaggcactcatcaca
gccatgggtacctcttccagctctgcaactctgcctatcactttccgatgcctggaggag
ggcctgggtgtggaccgccgcatcaccagattcgtgttgcctgtgggggccactgtcaac
atggacggcaccgcgctctatgaggccttggcagccatctttattgctcaagtcaacaac
tatgagctgaaccttggtcagatcaccacaatcagcatcacagccacagctgccagcgta
ggagcagctggcatcccccaggcaggactggttaccatggtgattgtgctcacatccgtc
ggcctgcccacagaggacatcacattgatcatagctgtggattggttccttgatcgactt
cgtacgatgaccaatgtacttggggactcaattggagcagctgtcattgagcatttgtcc
caacgggagctggagctgcaagaggctgagctgactctacccagcctggggaaaccctat
aagtcactcatggcacaagaaaagggggcatcaaggggtcggggaggtaatgagagtgtc
atgtga

DBGET integrated database retrieval system