KEGG   Rattus norvegicus (rat): 116546
Entry
116546            CDS       T01003                                 

Gene name
Ralb
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    116546 (Ralb)
   04015 Rap1 signaling pathway
    116546 (Ralb)
   04072 Phospholipase D signaling pathway
    116546 (Ralb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116546 (Ralb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116546 (Ralb)
   05212 Pancreatic cancer
    116546 (Ralb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116546 (Ralb)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    116546 (Ralb)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    116546 (Ralb)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    116546 (Ralb)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N
Other DBs
NCBI-GeneID: 116546
NCBI-ProteinID: NP_446273
RGD: 619852
Ensembl: ENSRNOG00000002440
UniProt: P36860
Position
13
AA seq 206 aa
MAANKGKSQGSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARGKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGRKSGKSKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgccaacaaaggcaagagccagggctccctggtccttcacaaggtcatcatggtc
ggcagtgggggagtcggcaagtcagccctgacgctccagttcatgtatgacgagtttgta
gaagactatgagcccaccaaagccgacagttacagaaagaaggtggttctcgacggagaa
gaggttcagatagacatcctggacacagccggccaggaggactatgcggccatccgtgac
aactacttccgaagcggagaaggctttctgctggtgttctccatcacggagcacgagtct
ttcaccgccacagctgagttcagggaacagatcctccgagtcaaggccgaggaggacaaa
atccctctgctggtcgtgggcaacaagtctgacctggaggagcggaggcaggtgcccgtg
gaggaggcccgaggcaaagcggaagagtggggtgtgcagtatgtggagacatccgcaaag
acccgagccaacgtggacaaggtgttctttgatctgatgagagaaatccgggcaaaaaag
atgtcggaaaacaaggacaagaacggcaggaaaagcggcaagagcaagaagagtttcaaa
gagcggtgctgcttgctgtga

KEGG   Rattus norvegicus (rat): 81757
Entry
81757             CDS       T01003                                 

Gene name
Rala
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno05132  Salmonella infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    81757 (Rala)
   04015 Rap1 signaling pathway
    81757 (Rala)
   04072 Phospholipase D signaling pathway
    81757 (Rala)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81757 (Rala)
  09162 Cancer: specific types
   05210 Colorectal cancer
    81757 (Rala)
   05212 Pancreatic cancer
    81757 (Rala)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81757 (Rala)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81757 (Rala)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    81757 (Rala)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    81757 (Rala)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    81757 (Rala)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ATP_bind_1 ThiF
Other DBs
NCBI-GeneID: 81757
NCBI-ProteinID: NP_112355
RGD: 619851
Ensembl: ENSRNOG00000013454
UniProt: P63322
Position
17
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaacaagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
ggcagtggtggtgtgggcaagtctgctctgactctgcagttcatgtatgatgagtttgta
gaagactatgaacctaccaaagcagacagctacaggaagaaggtagtgctggatggggag
gaagtgcagatcgacatcttagatacagcagggcaggaagactacgctgcaattagagac
aactacttccgaagtggggaaggattcctctgtgtcttctctatcacagagatggagtcc
tttgcagctacagcggacttcagggaacagattttaagagtaaaagaagatgagaatgtc
ccatttctcctggttggtaacaaatcagatttagaagataaaaggcaggtttctgtagaa
gaggcaaaaaacagagctgaccagtggaacgttaactatgtggagacgtctgctaaaacg
cgcgccaacgttgacaaggtattttttgatttaatgagggaaatacgagccagaaagatg
gaagacagcaaagaaaaaaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system