KEGG   Rattus norvegicus (rat): 116547
Entry
116547            CDS       T01003                                 

Gene name
S100a8
Definition
(RefSeq) protein S100-A8
  KO
K21127  protein S100-A8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    116547 (S100a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    116547 (S100a8)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  S100 proteins
   116547 (S100a8)
SSDB
Motif
Pfam: S_100 EF-hand_8 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_11 EF-hand_4
Other DBs
NCBI-GeneID: 116547
NCBI-ProteinID: NP_446274
RGD: 620265
Ensembl: ENSRNOG00000011557
UniProt: P50115
Position
2
AA seq 89 aa
MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDV
NSDNAINFEEFLVLVIRVGVAAHKDSHKE
NT seq 270 nt   +upstreamnt  +downstreamnt
atggcaactgaactggagaaggccttgagcaacgtcattgaagtctaccacaattattct
ggtataaaagggaatcaccatgccctctacagggatgacttcaggaaaatggtcactact
gagtgccctcagtttgtgcagaataaaaataccgaaagcttgttcaaagaattggacgtc
aatagtgacaacgcaattaacttcgaagagttccttgtgttggtgataagggtgggcgtg
gcagctcataaagacagccacaaggagtaa

DBGET integrated database retrieval system