KEGG   Rattus norvegicus (rat): 116549Help
Entry
116549            CDS       T01003                                 

Gene name
Csnk2a1
Definition
(RefSeq) casein kinase 2 alpha 1
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno04064  NF-kappa B signaling pathway
rno04137  Mitophagy - animal
rno04310  Wnt signaling pathway
rno04520  Adherens junction
rno05162  Measles
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    116549 (Csnk2a1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    116549 (Csnk2a1)
   04064 NF-kappa B signaling pathway
    116549 (Csnk2a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    116549 (Csnk2a1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    116549 (Csnk2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116549 (Csnk2a1)
  09172 Infectious disease: viral
   05162 Measles
    116549 (Csnk2a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116549 (Csnk2a1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    116549 (Csnk2a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     116549 (Csnk2a1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CK2 family
   116549 (Csnk2a1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  90S particles
   Kinase
    116549 (Csnk2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Kinase-like Choline_kinase ABC1
Motif
Other DBs
NCBI-GeneID: 116549
NCBI-ProteinID: NP_446276
RGD: 621663
Ensembl: ENSRNOG00000005276
UniProt: P19139
Structure
PDB: 

Position
3q41
AA seq 391 aa AA seqDB search
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSAGMAGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaacacacacagaccc
cgagagtactgggactatgaatcacatgtggtggaatggggaaatcaagatgactaccag
cttgttcgaaaattaggcaggggcaaatacagtgaagtgtttgaagccatcaatatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaaaaagaagaaaattaagcgt
gaaataaagattttggagaatttaagaggtgggcccaacatcatcacacttgcagacatt
gtgaaagaccctgtgtctcgaacccctgccttggtttttgaacatgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgacattcgattttacatgtatgaaatt
ctgaaagccctggattattgtcacagcatggggattatgcacagagacgtgaaaccgcat
aatgtcatgattgatcatgagcacagaaagcttcggctaatagattggggtttagcagag
ttttaccatcctggccaagagtataatgtccgagttgcttcccgatatttcaaaggtcca
gagctacttgtagattatcagatgtacgattatagtttggatatgtggagcttgggttgt
atgctggcaagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctgggaacggaagatttatatgactatattgacaag
tacaacattgaattagatccacgtttcaacgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcaccttgtcagccccgaggccttggatttt
ctggacaagctgctgcgatacgaccaccagtctcggctcactgcaagagaggccatggag
cacccttacttctacactgtcgtgaaggaccaggctcgaatgagttcggctggcatggca
gggggcagcacacctgtcagtagcgccaatatgatgtcagggatttcttcagtgccaacc
ccttcacccctgggacctctggcaggctcacccgtgattgctgctgccaactcacttggg
atacctgtaccagctgccgctggcgctcagcagtaa

DBGET integrated database retrieval system