KEGG   Rattus norvegicus (rat): 116549
Entry
116549            CDS       T01003                                 

Gene name
Csnk2a1
Definition
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno04064  NF-kappa B signaling pathway
rno04137  Mitophagy - animal
rno04310  Wnt signaling pathway
rno04520  Adherens junction
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05162  Measles
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    116549 (Csnk2a1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    116549 (Csnk2a1)
   04064 NF-kappa B signaling pathway
    116549 (Csnk2a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    116549 (Csnk2a1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    116549 (Csnk2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116549 (Csnk2a1)
  09172 Infectious disease: viral
   05162 Measles
    116549 (Csnk2a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116549 (Csnk2a1)
   05020 Prion disease
    116549 (Csnk2a1)
   05022 Pathways of neurodegeneration - multiple diseases
    116549 (Csnk2a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116549 (Csnk2a1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    116549 (Csnk2a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     116549 (Csnk2a1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CK2 family
   116549 (Csnk2a1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Kinase
    116549 (Csnk2a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Pkinase_fungal Kdo Choline_kinase DUF5898 FTA2 TCAD9
Other DBs
NCBI-GeneID: 116549
NCBI-ProteinID: NP_446276
RGD: 621663
Ensembl: ENSRNOG00000005276
UniProt: P19139
Structure
PDB: 
2R7I

Position
3
AA seq 391 aa
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSAGMAGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaacacacacagaccc
cgagagtactgggactatgaatcacatgtggtggaatggggaaatcaagatgactaccag
cttgttcgaaaattaggcaggggcaaatacagtgaagtgtttgaagccatcaatatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaaaaagaagaaaattaagcgt
gaaataaagattttggagaatttaagaggtgggcccaacatcatcacacttgcagacatt
gtgaaagaccctgtgtctcgaacccctgccttggtttttgaacatgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgacattcgattttacatgtatgaaatt
ctgaaagccctggattattgtcacagcatggggattatgcacagagacgtgaaaccgcat
aatgtcatgattgatcatgagcacagaaagcttcggctaatagattggggtttagcagag
ttttaccatcctggccaagagtataatgtccgagttgcttcccgatatttcaaaggtcca
gagctacttgtagattatcagatgtacgattatagtttggatatgtggagcttgggttgt
atgctggcaagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctgggaacggaagatttatatgactatattgacaag
tacaacattgaattagatccacgtttcaacgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcaccttgtcagccccgaggccttggatttt
ctggacaagctgctgcgatacgaccaccagtctcggctcactgcaagagaggccatggag
cacccttacttctacactgtcgtgaaggaccaggctcgaatgagttcggctggcatggca
gggggcagcacacctgtcagtagcgccaatatgatgtcagggatttcttcagtgccaacc
ccttcacccctgggacctctggcaggctcacccgtgattgctgctgccaactcacttggg
atacctgtaccagctgccgctggcgctcagcagtaa

KEGG   Rattus norvegicus (rat): 307641
Entry
307641            CDS       T01003                                 

Gene name
Csnk2a2
Definition
(RefSeq) casein kinase II subunit alpha'
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno04064  NF-kappa B signaling pathway
rno04137  Mitophagy - animal
rno04310  Wnt signaling pathway
rno04520  Adherens junction
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05162  Measles
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    307641 (Csnk2a2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    307641 (Csnk2a2)
   04064 NF-kappa B signaling pathway
    307641 (Csnk2a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    307641 (Csnk2a2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    307641 (Csnk2a2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    307641 (Csnk2a2)
  09172 Infectious disease: viral
   05162 Measles
    307641 (Csnk2a2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    307641 (Csnk2a2)
   05020 Prion disease
    307641 (Csnk2a2)
   05022 Pathways of neurodegeneration - multiple diseases
    307641 (Csnk2a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    307641 (Csnk2a2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    307641 (Csnk2a2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     307641 (Csnk2a2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CK2 family
   307641 (Csnk2a2)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Kinase
    307641 (Csnk2a2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Pkinase_fungal DUF5898 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 307641
NCBI-ProteinID: NP_001100879
RGD: 1306882
Ensembl: ENSRNOG00000011933
Position
19
AA seq 350 aa
MPGPAAGSRARVYSEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNY
DQLVRIAKVLGTDDLYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCAENTVLSSGLTAAR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcccggcccggccgcgggcagtcgggcccgggtctactccgaggtgaacagcctgagg
agccgcgagtactgggactacgaagcccacgtcccgagctggggtaatcaagatgattac
caactggttcgaaaacttggtcggggcaagtatagtgaagtatttgaggccattaacatc
accaacaatgagagggtggttgtaaaaattctcaagccagtgaagaaaaagaagataaaa
cgagaggttaagattctggagaaccttcgtggtggaacaaatatcattaagctgattgac
actgtaaaggaccctgtgtcaaagacaccagctttggtatttgaatatatcaataataca
gattttaagcaactctaccagatcctgactgactttgatatccggttttatatgtatgaa
ctacttaaagctctggattactgccacagcaagggaatcatgcacagggatgtgaaacct
cacaatgtcatgatagatcaccaacaaaaaaagctccggctgattgactggggtttggca
gaattctaccatcctgctcaggagtacaatgtccgagtggcctcgaggtacttcaaggga
ccagagctccttgtggactatcagatgtatgattacagcttggatatgtggagcttgggc
tgtatgttagcaagcatgatattccgaaaggagccattcttccatgggcaggacaactat
gaccagcttgttcgaattgccaaggttctggggacagatgacctgtatgggtatctgaag
aagtaccacatagacctagacccacacttcaatgatatcctgggacagcattcacggaag
cgctgggaaaactttatccatagtgagaacagacaccttgtcagccccgaggcccttgat
cttcttgacaagctcctgcggtacgaccatcaacagagattgaccgccaaagaggccatg
gagcacccgtacttctacccggtggtgaaggagcagtcccagccttgtgctgagaacacc
gtgctttccagtggtctcaccgcagcacgatga

KEGG   Rattus norvegicus (rat): 81650
Entry
81650             CDS       T01003                                 

Gene name
Csnk2b
Definition
(RefSeq) casein kinase II subunit beta
  KO
K03115  casein kinase II subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno04064  NF-kappa B signaling pathway
rno04137  Mitophagy - animal
rno04310  Wnt signaling pathway
rno04520  Adherens junction
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05162  Measles
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    81650 (Csnk2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    81650 (Csnk2b)
   04064 NF-kappa B signaling pathway
    81650 (Csnk2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    81650 (Csnk2b)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    81650 (Csnk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    81650 (Csnk2b)
  09172 Infectious disease: viral
   05162 Measles
    81650 (Csnk2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81650 (Csnk2b)
   05020 Prion disease
    81650 (Csnk2b)
   05022 Pathways of neurodegeneration - multiple diseases
    81650 (Csnk2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    81650 (Csnk2b)
   03036 Chromosome and associated proteins [BR:rno03036]
    81650 (Csnk2b)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Kinase
    81650 (Csnk2b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     81650 (Csnk2b)
SSDB
Motif
Pfam: CK_II_beta CCDC24
Other DBs
NCBI-GeneID: 81650
NCBI-ProteinID: NP_001030315
RGD: 619978
Ensembl: ENSRNOG00000000847
Vega: OTTRNOG00000000290
UniProt: P67874 Q68G11
Structure
PDB: 
2R6M

Position
20
AA seq 215 aa
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa
ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtgcctcactatcgacaagccctagacatgatcttggacctggaacctgatgaa
gagctggaagacaaccccaaccagagtgacttgattgagcaggcggccgagatgctctat
gggttgatccacgcccgctacatcctcaccaaccggggcattgcacaaatgttggaaaag
taccagcaaggagactttggctactgtcctcgagtatactgtgagaaccagccgatgctt
cccatcggcctttcggacatcccaggagaggccatggtgaagctctactgccccaagtgc
atggacgtgtacacacccaagtcctctaggcaccaccacacggatggcgcatacttcggc
actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagcggccggcc
aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system