KEGG   Rattus norvegicus (rat): 116551Help
Entry
116551            CDS       T01003                                 

Gene name
Pdk1
Definition
(RefSeq) pyruvate dehydrogenase kinase 1
  KO
K12077  pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04360  Axon guidance
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    116551 (Pdk1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    116551 (Pdk1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    116551 (Pdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116551 (Pdk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     116551 (Pdk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   116551 (Pdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 116551
NCBI-ProteinID: NP_446278
RGD: 69427
Ensembl: ENSRNOG00000001517
UniProt: Q5FVT5
Position
3q23
AA seq 434 aa AA seqDB search
MRLARLLRGGTSVRPLCAVPCASRSLASDSASGSGPASESGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVIKDGYENARRLCDL
YYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIQ
VHVTLGEEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPIS
RLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESIERLPVYNKAAWKHYRTNHEADDWCV
PSREPKDMTTFRSS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcaaggctgctgcggggcggcacgagcgtcaggccgctctgtgccgtcccc
tgcgccagccgtagtctggcctcggactcggcctcgggctccgggccggcgtcggagagc
ggcgttccgggccaggtggacttctatgcgcgcttctcgccgtcgccactctccatgaag
cagttcctggacttcgggtcagtaaatgcttgtgaaaagacctcgttcatgtttcttcga
caagagttgcctgttagattggcaaatataatgaaagaaataagtctccttcccgataat
cttctcaggaccccatccgtacagctggtacaaagttggtatatccaaagccttcaggag
ctgcttgactttaaggacaagagtgctgaggatgctaaaactatttatgaattcacagac
acagtgataaggatcagaaaccggcacaatgatgtcatccccaccatggcccagggtgtg
actgaatacaaggagagcttcggggtggatcctgtcaccagccaaaatgttcagtacttt
ttggatcggttctacatgagtcgcatctcaattagaatgctactcaaccagcactcttta
ttgtttggtggaaaaggaagtccatctcatcgaaaacacattggaagcataaatccaaac
tgtgatgtagtcgaggttattaaagatggctatgagaatgcgagacggctttgtgatttg
tattacattaactctcctgaactagaacttgaagaactaaatgcgaaatcaccaggacag
ccaatacaagtggtttatgttccgtcccatctctatcacatggtgtttgaactgttcaag
aacgcaatgagggccaccatggagcaccatgcagacaaaggcgtttatcccccgattcaa
gttcacgtcacactgggggaggaggatttgactgtgaagatgagtgaccggggaggtggt
gttccgctgaggaagatcgacagactcttcaactacatgtactcaactgcaccccggcct
cgtgttgagacgtcccgtgcggtgcccctggctggatttggttacggattgcccatatca
cgcctctatgcacagtacttccagggagacctaaagctgtattccttagagggctacggg
acggatgctgtcatctatattaaggctctgtcaacggagtccatcgaaagactccctgtg
tataataaagctgcctggaagcattacagaaccaaccacgaggctgacgactggtgtgtg
cccagcagagagccgaaagacatgacgacgttccgaagctcgtaa

DBGET integrated database retrieval system