KEGG   Rattus norvegicus (rat): 116553Help
Entry
116553            CDS       T01003                                 

Gene name
Il13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04664  Fc epsilon RI signaling pathway
rno05200  Pathways in cancer
rno05310  Asthma
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    116553 (Il13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116553 (Il13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    116553 (Il13)
   04657 IL-17 signaling pathway
    116553 (Il13)
   04664 Fc epsilon RI signaling pathway
    116553 (Il13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116553 (Il13)
  09163 Immune disease
   05310 Asthma
    116553 (Il13)
   05321 Inflammatory bowel disease (IBD)
    116553 (Il13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116553 (Il13)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   116553 (Il13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL13
Motif
Other DBs
NCBI-GeneID: 116553
NCBI-ProteinID: NP_446280
RGD: 68949
Ensembl: ENSRNOG00000007652
UniProt: P42203
Position
10q22
AA seq 131 aa AA seqDB search
MALWVTAVLALACLGGLATPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSV
DLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLL
NYSKQLFRYGH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcactctgggtgactgcagtcctggctctcgcttgccttggtggtcttgccacccca
gggccagtgcggagatccacatctccccctgtggccctcagggagcttatcgaggagctg
agcaacatcacacaagaccagaagacttccctgtgcaacagcagcatggtatggagcgtg
gacctgacagctggcgggttctgtgcagccctggaatccctgaccaacatctccagttgc
aatgccatccacaggacccagaggatattgaatggcctctgtaaccaaaaggcctcggat
gtggcttccagccccccagataccaaaatcgaagtagcccagtttatatcaaaactgctc
aattactccaagcaacttttccgctatggccactga

DBGET integrated database retrieval system