KEGG   Rattus norvegicus (rat): 116555
Entry
116555            CDS       T01003                                 

Gene name
Nup107
Definition
(RefSeq) nucleoporin 107
  KO
K14301  nuclear pore complex protein Nup107
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    116555 (Nup107)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    116555 (Nup107)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    116555 (Nup107)
   03036 Chromosome and associated proteins [BR:rno03036]
    116555 (Nup107)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     116555 (Nup107)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    116555 (Nup107)
SSDB
Motif
Pfam: Nup84_Nup100
Other DBs
NCBI-GeneID: 116555
NCBI-ProteinID: NP_446282
RGD: 621160
Ensembl: ENSRNOG00000006541
UniProt: F1LSL2
Position
7q22
AA seq 925 aa
MDRSGFGGMSSPVIRDPEVTRTARKHSAHKRVLIQANQDENFGTTTPRSQIIPRTPSSFR
QPFTPPSRSLLRHPDISYIFGTEGRSPRHIQSSGYLGNLSMVTNLDDSNWAAAFSSQRLG
FYTNTEHHSMTEDINLSTVMLREDDPGEAASMSMFSDFLQSFLKHSSTTVFDLVEEYENI
CASQVNILSKIVSRATPGLQKFSKTASMLWLLQQEMVTWRLLASLYRDRIQSSLEEENMF
AIAGINASEKTVVEALFQRDTLVRQSQLVVDWLESIAKDEIGDFSDNIEFYAKSVYWENT
LHSLKQRQLLSYIGSTRPLVTELDPDAPIRQKMPLDDLDREDEVRLLKYLFTLIRAGMTE
EAQRLCKRCGQAWRAATLEGWKLHHDPNVNGGTELEPVEGNPYRRIWKISCWRMAEDELF
NKYERAIYAALSGNLKQLLPVCDTWEDTVWAYFRVMVDSLVEQEIRTSVMTLDETEELPR
EYMEANWTLEKVFEELQATDKKRVLEENQEHYHVVQKFLILGDIDGLMDEFSKWLSKSRS
SLPGHLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLINEKHTNLIAFYTCHLPQDL
AVAQYALFLEGVTECEQRHQCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAPSL
DTATTEEDRLKIDVIDWLVFDPAQRAEALRQGNAIMRKFLALKKHEAAKEVFVKIPQDSI
AEIYNQWEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSAPQKPTLLSQA
TFTEKVAHEHKEKKYEMDHNIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAEEDP
ERAHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKL
LQKLRESSLMLLDQGLDPLGYEIQS
NT seq 2778 nt   +upstreamnt  +downstreamnt
atggacaggagtggcttcgggggaatgtcatcccctgtgatccgagacccagaggttacg
aggactgcacggaagcatagtgctcacaaaagagttttaattcaggccaaccaagatgaa
aattttggtactactacaccaagaagccagattattcctcgaactccaagctcatttcga
caaccttttactccaccaagccgaagtttactaagacacccagatatatcctacattttt
gggacggaagggaggtctccccggcatatacagtcttctgggtatttgggaaatctttcc
atggtgactaaccttgatgacagcaactgggcagctgcattctcatcccagcgtttaggg
ttctacacaaacacggagcaccatagtatgactgaggacataaacctaagtactgtcatg
ctacgggaggatgaccctggagaggctgcatccatgagtatgttctctgatttcctgcag
tctttcttgaagcactcttcaaccacagtctttgatcttgtagaagagtatgaaaatatt
tgtgctagtcaggtgaacatcctgagtaaaatcgtgagccgagcaacgcctggactgcag
aagttctccaagacagccagcatgctctggcttctccagcaggagatggtcacgtggagg
ctgcttgcctctttgtatagagacagaatacagtcttcattagaagaggaaaatatgttt
gcaattgctggtatcaatgccagtgagaagacggttgtggaagcgctgtttcagagggac
acgctggtccgacagagccagttggtggtagattggctagagagcattgccaaagatgaa
attggagatttctcagacaatattgagttttatgcaaaatcagtatattgggaaaataca
ctccactccttaaaacagcggcagctgctgtcttatataggaagtacccgtcctcttgtc
actgagctggacccagatgctcccattagacagaaaatgccgctggatgatctggacaga
gaagatgaagtcagactgctgaagtacctcttcactctaatccgtgctgggatgaccgag
gaggcacagaggctctgtaaacggtgcgggcaagcatggagagctgcaaccctggaagga
tggaagctgcaccacgaccccaacgtgaatggagggacagagctagagcctgtcgaaggg
aatccatatagacggatctggaagattagttgctggagaatggctgaagatgaacttttt
aataaatacgaaagagcgatttatgcagcactcagtgggaatctcaagcagctccttccg
gtctgtgacacctgggaagacacagtgtgggcctatttccgggtgatggtggacagcctg
gtggagcaggagattcgcacctcagtcatgaccctagatgaaactgaggagctccctcgg
gagtacatggaagcgaattggaccttagaaaaagtttttgaagagcttcaagccactgat
aagaagagagttctggaagagaatcaagaacattaccatgtagtccagaaattccttatc
ctgggagacattgatggtttgatggatgaatttagcaaatggctgtccaagagcagaagc
agtctacctggacacctcctccgttttatgactcacctcattctgtttttccgcaccctg
ggactgcagaccaaagaagaagtttccattgaagttctaaagacgtatatacagctgtta
atcaatgagaagcacacaaacctcatagcgttctatacctgtcatctgcctcaagacctt
gcggttgcccaatacgccttgtttttggagggtgttacggagtgtgagcagcggcaccag
tgcctggagctggctaaggaggcagatttggatgttgcgactataacaaaaactgtagtt
gaaaatattcggaagaaagataatggtgaattcagtcaccatgacctggctccatccctg
gatactgccactactgaggaggaccgtttgaagatcgatgtgattgactggctggtgttt
gacccagcgcagagagccgaagccctgagacaaggcaacgccatcatgaggaagttctta
gcattaaagaaacatgaagctgcaaaagaagtgtttgtgaaaattcctcaggattccatc
gcagaaatctataatcagtgggaggagcaaggcatggagagccctcttcctgccgaggat
gataacgctatccgagagcacttgtgtatcagagcttatctggaagcccatgaaaccttc
aatgagtggtttaaacatatgaattcggctcctcagaaacctacactgctgtcccaggcg
acttttacagagaaagtggctcacgagcacaaagaaaagaagtacgagatggatcataat
atttggaaaggacatttggatgctctaactgctgatgtgaaggagaaaatgtacaacgtc
ttattgtttgttgatggaggatggatggtggatgtcagagaggacgctgaggaagacccg
gaacgagctcatcagatggttttgctgagaaagctctgtctccccatgctgtgcttcctg
cttcacaccatactgcacagcaccgggcaataccaggagtgcctgcagctggccgacatg
gtgtcctctgagcgccacaagctctatctggtattttctaaggaagaactaaggaaactg
ctgcagaagttaagggagtcctcgctgatgctcctagaccaggggcttgacccgctcggc
tatgaaatccagtcataa

DBGET integrated database retrieval system