KEGG   Rattus norvegicus (rat): 116557Help
Entry
116557            CDS       T01003                                 

Gene name
Foxj1, Hfh-4, Hfh4
Definition
(RefSeq) forkhead box J1
  KO
K09402  forkhead box protein J1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    116557 (Foxj1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix tissue-specific regulators
    116557 (Foxj1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 116557
NCBI-ProteinID: NP_446284
RGD: 621764
UniProt: Q63247
Position
10q32.1
AA seq 421 aa AA seqDB search
MAESWLRLCGAGPGEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPL
GYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHV
KPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFI
KVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSTAPWGGP
LTVNREAQQLLQEFEEATGEGGWGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQG
ELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGEVDLTVHGRHINCPATWG
PPVEQATDSLDFDETFLATSFLQHPWDESSSGCLPPEPLFEAGDATLAADLQDWASVGAF
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagctggctgcgcctctgcggagcggggcccggggaggaggccgggccggaa
ggtggcatggaggagccggacgccctggatgacagcctgaccagcttgcaatggctgcag
gaattctccattctcaacgccaaggcccccactcttcccccgggaggcaccgaccccctt
ggctaccaccaagtaccgggtttggtggcgcccggatcaccgctggcggcagaccctgcc
tgccttgggcagccacacacacccggcaagcccacatcgtcgtgcacatctcgaagcgcg
cccccagggctgcaggccccgccccctgacgacgtggactatgccaccaacccacatgtg
aagccgccctactcgtatgccactctcatctgcatggccatgcaagccagcaaggccacc
aagatcactctgtcggccatctacaagtggatcacggacaacttctgctacttccgccat
gctgaccccacctggcagaattccatccgccacaacctgtccttgaacaagtgcttcatc
aaagtgcctcgggagaaggatgagcccggcaaggggggcttctggcgcatcgacccccag
tatgcagaacgcctgctcagtggggccttcaagaagcggaggctgcccccggtccacatc
caccctgcctttgcccggcaggccgcccaggaacccagcactgccccctggggtgggcct
ctgaccgtgaacagggaggcccagcagctactgcaggagtttgaggaggccacaggggag
ggaggctggggcacaggagagggaaggctggggcataagcgaaagcagccgctgcccaag
agggtggccaaggtcctgcggcctcccagcaccttgctgctgacccaggaggagcagggt
gagctggaacccctcaaaggtaactttgactgggaggccatcttcgaggctggcgcactg
ggtgaggagctgagctcactggagggtctggaactaagccccccgctgagccccagctca
cacggagaggtggatctcacagtccatggccgccacatcaactgtcctgctacctggggc
cctccagtggagcaggctactgacagcctggactttgatgagaccttcctggccacgtcc
ttcctccagcatccctgggacgagagtagtagcggttgcctgcccccagaacccctcttt
gaagcaggggatgccaccctggccgctgacctgcaggactgggccagtgtgggagccttc
ttataa

DBGET integrated database retrieval system