KEGG   Rattus norvegicus (rat): 116558Help
Entry
116558            CDS       T01003                                 

Gene name
Il9
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    116558 (Il9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116558 (Il9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    116558 (Il9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116558 (Il9)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   116558 (Il9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7
Motif
Other DBs
NCBI-GeneID: 116558
NCBI-ProteinID: NP_001099217
RGD: 620049
Ensembl: ENSRNOG00000012131
UniProt: D4A8I9
Position
17p14
AA seq 144 aa AA seqDB search
MFVTYVLASALLFGSVLGQRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIP
SDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGN
TVSFLKSLLKTFQKTEVQVQRSRA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgacatacgtccttgcctctgctttgctctttgggtctgtcctgggccagaga
tgcagcacctcctggggcatccaacacacctcttaccttattgaaaacctgaaggacgac
ccatcatcaaaatgcagctgcagtgccaacgtgaccagctgcttgtgcctccccatccca
tctgatgattgtaccacaccgtgcttccaggagggaatgtcacaggtgaccaatgccacc
cagcaatcaaaattctcaccttttttctttcgggtgaaaaggatagttgaaaccctaaag
agcaacaagtgtcagtttttctcctgtgaaaagccgtgcaaccagaccacagcaggcaac
accgtgtcatttctgaagagtctcctgaagaccttccagaagacagaggtgcaagtgcag
agaagcagggcgtga

DBGET integrated database retrieval system