KEGG   Rattus norvegicus (rat): 116561Help
Entry
116561            CDS       T01003                                 

Gene name
Cltb
Definition
(RefSeq) clathrin, light chain B
  KO
K04645  clathrin light chain B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116561 (Cltb)
   04142 Lysosome
    116561 (Cltb)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    116561 (Cltb)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116561 (Cltb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    116561 (Cltb)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    116561 (Cltb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116561 (Cltb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    116561 (Cltb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q GED
Motif
Other DBs
NCBI-GeneID: 116561
NCBI-ProteinID: NP_446287
RGD: 621353
Ensembl: ENSRNOG00000017506
UniProt: P08082
Position
17p14
AA seq 229 aa AA seqDB search
MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDSGFGAPAASQVASAQPGLA
SGGGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFV
KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggacttcggcttcttctcgtcgtcggagagcggggcccccgaggccgccgag
gaggacccggcggccgccttcctggcccagcaggagagcgagattgctggcatcgagaat
gactcgggtttcggggcacctgccgccagccaggtggcctctgcgcagcccggactcgcg
agcgggggtggttcggaggacatggggactacagtcaatggagatgtgtttcaggaggct
aacgggcctgccgatggctacgctgcgattgcccaggcggacaggttgactcaggagcct
gagagcatccgcaagtggagagaggagcagaagaaaaggctgcaggagttggatgctgcc
tcgaaggtgaccgaacaggagtggcgggagaaggccaaaaaagacctggaggagtggaac
cagcgccaaagtgaacaggttgagaagaacaagatcaacaacaggatcgctgacaaagcg
ttctaccagcagccagatgctgataccattggctatgtggcatcggaagaggcttttgtg
aaagaatccaaggaggagaccccaggcacagagtgggagaaggtggcccagctgtgtgac
ttcaaccctaagagcagcaagcaatgtaaagacgtgtcccgcctgcgctcggtgctcatg
tccctgaagcagacgccactgtcccgctag

DBGET integrated database retrieval system