KEGG   Rattus norvegicus (rat): 116561
Entry
116561            CDS       T01003                                 

Gene name
Cltb
Definition
(RefSeq) clathrin light chain B
  KO
K04645  clathrin light chain B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116561 (Cltb)
   04142 Lysosome
    116561 (Cltb)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    116561 (Cltb)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116561 (Cltb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    116561 (Cltb)
  09164 Neurodegenerative disease
   05016 Huntington disease
    116561 (Cltb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116561 (Cltb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    116561 (Cltb)
SSDB
Motif
Pfam: Clathrin_lg_ch CENP-Q GED
Other DBs
NCBI-GeneID: 116561
NCBI-ProteinID: NP_446287
RGD: 621353
Ensembl: ENSRNOG00000017506
UniProt: P08082
Position
17
AA seq 229 aa
MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDSGFGAPAASQVASAQPGLA
SGGGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFV
KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 690 nt   +upstreamnt  +downstreamnt
atggctgaggacttcggcttcttctcgtcgtcggagagcggggcccccgaggccgccgag
gaggacccggcggccgccttcctggcccagcaggagagcgagattgctggcatcgagaat
gactcgggtttcggggcacctgccgccagccaggtggcctctgcgcagcccggactcgcg
agcgggggtggttcggaggacatggggactacagtcaatggagatgtgtttcaggaggct
aacgggcctgccgatggctacgctgcgattgcccaggcggacaggttgactcaggagcct
gagagcatccgcaagtggagagaggagcagaagaaaaggctgcaggagttggatgctgcc
tcgaaggtgaccgaacaggagtggcgggagaaggccaaaaaagacctggaggagtggaac
cagcgccaaagtgaacaggttgagaagaacaagatcaacaacaggatcgctgacaaagcg
ttctaccagcagccagatgctgataccattggctatgtggcatcggaagaggcttttgtg
aaagaatccaaggaggagaccccaggcacagagtgggagaaggtggcccagctgtgtgac
ttcaaccctaagagcagcaagcaatgtaaagacgtgtcccgcctgcgctcggtgctcatg
tccctgaagcagacgccactgtcccgctag

KEGG   Rattus norvegicus (rat): 54241
Entry
54241             CDS       T01003                                 

Gene name
Cltc
Definition
(RefSeq) clathrin heavy chain 1
  KO
K04646  clathrin heavy chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    54241 (Cltc)
   04142 Lysosome
    54241 (Cltc)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    54241 (Cltc)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    54241 (Cltc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    54241 (Cltc)
  09164 Neurodegenerative disease
   05016 Huntington disease
    54241 (Cltc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    54241 (Cltc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    54241 (Cltc)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    54241 (Cltc)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   54241 (Cltc)
SSDB
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_1
Other DBs
NCBI-GeneID: 54241
NCBI-ProteinID: NP_062172
RGD: 2364
Ensembl: ENSRNOG00000004291
UniProt: P11442
Structure
PDB: 
1BPO 1C9I 1C9L

Position
10
AA seq 1675 aa
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt   +upstreamnt  +downstreamnt
atggcccagattctgccaattcgctttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccctgactatggagtcagacaaattcatctgcatt
agagaaaaagtgggagagcaggctcaggtggtgatcattgacatgaatgatccaagtaat
ccgattcgaagaccaatctcagcagacagtgccatcatgaatcctgccagcaaagtgatt
gcactgaaagctggaaaaactctacagatatttaacattgaaatgaaaagtaaaatgaag
gcccacaccatgaccgatgatgtcaccttctggaaatggatctctctgaatacggttgct
cttgttacggataatgcagtttatcactggagcatggagggggagtctcagccagtgaag
atgtttgatcgtcattccagcctcgcagggtgccagatcatcaattaccgtacagatgct
aagcagaagtggttgctcctgactggcatatctgcacagcaaaatcgcgtggttggagct
atgcagctgtattctgtagacaggaaagtctctcagcccattgaagggcatgcggcgagt
tttgcacaatttaagatggaaggaaacgcagaagaatcgacgttattttgttttgctgtg
cggggtcaggcaggggggaagttacatatcattgaagttggtacaccacccacaggaaac
caaccctttccaaagaaggcagtggatgtcttctttcctccagaagcacaaaatgatttt
cctgttgcaatgcagatcagtgaaaagcatgacgtggtgttcctgattaccaagtatggt
tatattcacctctatgaccttgagactggcacgtgcatctacatgaacagaatcagtgga
gaaaccatctttgttactgctcctcatgaagccacagctggaataataggagtcaacaga
aagggacaagtcctatcagtttgtgtggaagaagagaacataattccttacatcaccaat
gtcctacaaaatcctgatttggctctgagaatggctgtgcggaacaacctagctggtgca
gaagagctcttcgcccggaaatttaatgctctcttcgcccagggaaactactcagaggct
gcaaaggtggctgctaatgcaccgaagggaatccttcgtactccagataccatccgtcga
ttccagagtgtcccagctcagccaggtcaaacttcacctctgcttcagtattttggaatc
cttttggaccaaggccagctgaacaaatacgagtccttagagttatgtagacctgtcctt
cagcaagggcggaaacaacttttggagaaatggctgaaagaagataagctggaatgttct
gaagaactgggtgatctcgtaaaatctgtggacccaacgttagcactgagtgtatacctc
agagccaatgtccctaataaagtcatccagtgctttgcagagacaggtcaagtccagaag
attgttttatatgctaaaaaagttggctatactccagactggatctttctcctgagaaat
gtcatgcggatcagtccagatcaaggacagcagtttgcccaaatgttagttcaggacgaa
gaacctcttgctgatatcacacagattgtggatgtctttatggaatacaatctaatccaa
caatgtactgccttcttacttgatgctttgaagaataatcgcccttctgaaggtcctttg
cagacgcgattgcttgagatgaaccttatgcacgcacctcaagttgcagatgccattcta
gggaatcagatgttcacccactatgaccgggctcacatcgcccagctgtgtgagaaggcg
ggcctactgcagcgtgcattagaacatttcaccgacttatatgatataaaacgagcagtc
gttcatacccatcttctcaaccccgagtggttagtgaattactttgggtccttatcagtt
gaagattccctagaatgtctcagagccatgctgtctgctaatattcgtcaaaatctacag
atctgtgttcaggtcgcttctaaatatcatgaacagctgtcaactcagtccctgattgaa
ctcttcgagtcattcaagagttttgaaggcctcttttattttctggggtccattgttaac
ttcagtcaagacccagatgtgcactttaaatatattcaggcggcttgcaagactggacaa
atcaaagaggtggaaagaatctgcagagagagcaactgctatgatccagagcgcgtcaag
aatttcctcaaggaggcgaaactcacagatcagttgccactcatcatcgtctgtgaccgc
tttgacttcgtccatgacctggtgctgtatttatacagaaacagtcttcagaagtacata
gagatatatgtccagaaagtaaatccaagtcgacttcctgtggttattggaggattgctg
gatgttgactgctctgaagatgtcattaaaaatttgattcttgttgtgagaggtcaattc
tctactgatgagcttgttgctgaagttgagaaaagaaacagattgaagctgcttcttcct
tggcttgaggctagaattcatgagggctgtgaggagcctgctacacacaatgcgttagcc
aaaatatacatcgacagcaataacaacccagagagattccttcgtgaaaacccctactat
gacagtcgtgtcgtgggaaagtactgtgagaagagagacccacatctggcctgtgttgct
tatgaacgtggccagtgtgatctggaactaatcaacgtttgcaatgagaattccctcttc
aaaagtctttctcgctacctggtccgtcgaaaggatccagagttgtggggtagtgtgcta
ctggaaagcaatccatacagaagaccattaattgaccaggtcgtacagacagccttgtct
gaaactcaggacccagaagaagtgtcagtaactgtcaaggcttttatgacagcagatctt
cctaatgaactcattgagctgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatctgcaaaacctcctcatcctcactgcaattaaggctgaccgaacccgagtt
atggagtatattaaccgcctggacaattatgatgcgccagatattgccaacattgccatc
agcaatgagctcttcgaagaagcatttgctattttccggaagtttgatgtcaatacttca
gcagtgcaggtgttaattgaacatattggaaacctggatcgtgcatatgagtttgctgaa
cgctgcaatgagcctgctgtttggagtcaactcgcaaaagctcagttgcagaaagggatg
gtgaaggaagccattgattcttacatcaaagcagatgatccttcgtcttacatggaagtt
gttcaggccgccaatactagtggaaactgggaagaattggtgaagtatttgcagatggca
cgcaagaaggcccgagagtcctacgtggagacagaattgatatttgcactggctaaaaca
aaccgtcttgcagaattagaagagttcatcaatgggccaaataatgctcatattcagcaa
gttggtgaccgttgttatgatgagaaaatgtatgatgctgctaagttgttgtacaataat
gtttctaactttggacgtttggcgtctaccctggttcaccttggcgagtatcaggcagca
gttgatggtgctagaaaagctaatagtactcgaacatggaaagaggtctgctttgcctgt
gtagatgggaaagagtttcgccttgctcagatgtgtggactccatattgttgtgcatgca
gatgaattagaggagcttatcaactactatcaggatcgtggatattttgaagaactcatc
accatgttggaggcagccttgggactagagcgagctcacatgggaatgttcacagagcta
gcaattttgtattctaaattcaagccacagaaaatgagggaacacctagagttgttttgg
tcaagagtgaatattcctaaggtgctgagagccgcagagcaagcccatctttgggcagag
ctggtgtttctgtatgacaagtatgaagagtatgataatgccatcatcactatgatgaat
caccccaccgacgcatggaaggaagggcagttcaaagacatcatcaccaaggtggctaat
gtggaactgtactacaaagcaatccagttctacttagaattcaagcccttgttgttaaat
gacttgctcatggtgctgtctccacggttggatcatactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaaaccatatttacgctcagttcagaaccacaacaac
aagtccgtgaacgaatccctgaacaacctctttatcacagaggaggattaccaggctctg
cgaacatcaatagatgcttatgacaactttgacaacatctcacttgctcaacgtttggaa
aaacatgaactcattgaattcagaagaattgctgcttatctcttcaaaggaaacaatcgc
tggaaacagagtgtggagctgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcctctgaatcgaaagacacagaattggctgaagaactcctgcagtggtttctgcaggaa
gagaagagagaatgctttggagcttgtctcttcacctgctacgatcttttaaggccagat
gttgtcctggaaactgcatggagacataatatcatggattttgccatgccctatttcatc
caggtcatgaaggagtatttgaccaaggtggataaattagatgcttcggagtcactgaga
aaagaagaagaacaagctacagagacacagcccattgtttatggtcagccccagctgatg
ctaacagccggacccagtgtggcagtccctccccaggcaccttttggttatggttatact
gcaccaccatatgggcagccacagcctggctttgggtacagcatgtga

KEGG   Rattus norvegicus (rat): 83800
Entry
83800             CDS       T01003                                 

Gene name
Clta
Definition
(RefSeq) clathrin light chain A
  KO
K04644  clathrin light chain A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83800 (Clta)
   04142 Lysosome
    83800 (Clta)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    83800 (Clta)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    83800 (Clta)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    83800 (Clta)
  09164 Neurodegenerative disease
   05016 Huntington disease
    83800 (Clta)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83800 (Clta)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83800 (Clta)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    83800 (Clta)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   83800 (Clta)
SSDB
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Other DBs
NCBI-GeneID: 83800
NCBI-ProteinID: NP_114180
RGD: 70919
Ensembl: ENSRNOG00000014635
UniProt: P08081
Position
5
AA seq 248 aa
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQAHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER
LEALDANSRKQEAEWKEKAVKELEEWYARQDEQLQKTKASNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgagttggatccatttggcgctcccgccggtgcgcccggtggccccgcgctcggg
aacggggtggcgggcgccggcgaggaagacccggccgcggccttcttggcgcagcaggag
agtgagattgcgggcatagagaacgacgaggccttcgccatcctagacggcggcgccccc
gggccgcaggcacacggcgagccgccggggggtcctgatgcggttgatggagtgatgaat
ggcgaatactaccaggagagcaatggtccaacagacagttacgcagccatttcagaagtg
gatcggttgcagtcagagcctgaaagtatccgtaagtggagagaagagcagacagagcgc
ctggaagccctcgatgccaattctcggaagcaggaagcagagtggaaagaaaaggcagtg
aaggagctggaagagtggtacgcaaggcaggatgagcagctacagaagacaaaagccagc
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtc
acaaacataaaccatccttgctacagcctagaacaggcagcagaagaagcctttgtaaac
gacattgacgagtcatccccaggcactgagtgggagcgggtggcccgcctgtgtgacttt
aaccccaagtccagcaaacaggccaaagatgtctctcgcatgcgctcagtcctcatctcc
ctgaagcaggcgcccctggtgcattga

DBGET integrated database retrieval system