KEGG   Rattus norvegicus (rat): 116562Help
Entry
116562            CDS       T01003                                 

Gene name
Il2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04151  PI3K-Akt signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05135  Yersinia infection
rno05142  Chagas disease (American trypanosomiasis)
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease (IBD)
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    116562 (Il2)
   04151 PI3K-Akt signaling pathway
    116562 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116562 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    116562 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    116562 (Il2)
   04660 T cell receptor signaling pathway
    116562 (Il2)
   04658 Th1 and Th2 cell differentiation
    116562 (Il2)
   04659 Th17 cell differentiation
    116562 (Il2)
   04672 Intestinal immune network for IgA production
    116562 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116562 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    116562 (Il2)
   05321 Inflammatory bowel disease (IBD)
    116562 (Il2)
   05330 Allograft rejection
    116562 (Il2)
   05332 Graft-versus-host disease
    116562 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    116562 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    116562 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116562 (Il2)
   05162 Measles
    116562 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    116562 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116562 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    116562 (Il2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   116562 (Il2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Cytokines
   116562 (Il2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2 Peptidase_M23_N
Motif
Other DBs
NCBI-GeneID: 116562
NCBI-ProteinID: NP_446288
RGD: 620047
Ensembl: ENSRNOG00000017348
UniProt: P17108
Position
2q25
AA seq 155 aa AA seqDB search
MYSMQLASCVALTLVLLVNSAPTSSPAKETQQHLEQLLLDLQVLLRGIDNYKNLKLPMML
TFKFYLPKQATELKHLQCLENELGALQRVLDLTQSKSFHLEDAGNFISNIRVTVVKLKGS
ENKFECQFDDEPATVVEFLRRWIAICQSIISTMTQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcatgcagctcgcatcctgtgttgcactgacgcttgtcctccttgtcaacagc
gcacccacttcaagccctgcaaaggaaacacagcagcacctggagcagctgttgctggac
ttacaggtgctcctgagagggatcgataattacaagaatctgaaactccccatgatgctc
acgtttaaattttacttgcccaagcaggccacagaattgaaacatcttcagtgcctggaa
aatgaactcggagctctgcagcgtgtgttggatttgactcaaagcaaaagctttcacttg
gaagacgctggaaatttcatcagcaatatcagagtaactgttgtaaaactaaagggctct
gaaaacaaatttgagtgccaattcgatgatgagccagcaactgtggtggaatttctgagg
agatggatagccatctgtcaaagcatcatctcaacaatgactcagtaa

DBGET integrated database retrieval system