KEGG   Rattus norvegicus (rat): 116563
Entry
116563            CDS       T01003                                 

Gene name
Ap2m1, Ap50, Clapm1, mu2
Definition
(RefSeq) adaptor-related protein complex 2, mu 1 subunit
  KO
K11826  AP-2 complex subunit mu-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116563 (Ap2m1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    116563 (Ap2m1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116563 (Ap2m1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    116563 (Ap2m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116563 (Ap2m1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    116563 (Ap2m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Other DBs
NCBI-GeneID: 116563
NCBI-ProteinID: NP_446289
RGD: 620135
Ensembl: ENSRNOG00000001709
UniProt: P84092
Structure
PDB: 

Position
11q23
AA seq 435 aa
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatcggaggcttattcatctataatcacaagggggaggtgcttatctcccgagtctac
agagatgacatcgggaggaatgcagtggatgcctttcgcgtcaatgtcattcacgcacgg
cagcaggtgcgcagccctgtcacaaacatcgctcgcaccagcttcttccatgttaagcgg
tccaacatctggctggcagcagtcaccaagcagaatgtcaatgccgccatggtcttcgaa
ttcctctacaagatgtgtgatgtaatggctgcttactttggcaagatcagcgaggagaac
atcaagaacaatttcgtgctcatatacgagctgctggacgagattctggactttggctac
ccacagaactcagagacaggtgcactgaaaaccttcatcacccaacagggtatcaagagt
cagcatcagacaaaagaagagcagtcccagatcaccagccaggtgaccgggcaaattggc
tggaggcgggaaggcatcaagtatcgtcggaatgaactcttcctagatgttctggagagt
gtgaacctgcttatgtccccacaggggcaggtgctgagtgcccatgtgtcgggccgggtg
gtgatgaagagttacctgagcggcatgcctgagtgcaagtttggaatgaatgacaagatt
gtcatagaaaagcagggcaaaggcacagccgatgaaacaagcaagagtggtaagcagtcg
atcgccattgatgactgcacctttcaccagtgtgtgcgactcagcaagtttgactctgag
cggagcatcagctttatccctcctgatggagagtttgaactcatgagataccgtactacc
aaggacatcatcctgcctttccgggtgatcccattggtgcgggaggtgggacgcaccaaa
ctggaggtcaaggtggtcatcaagtccaacttcaagccctcacttctggcccagaagatt
gaggtgaggatcccaaccccattgaacacaagcggggtgcaagtgatctgcatgaagggg
aaggccaagtacaaggccagcgagaacgccattgtatggaagatcaagcgcatggcaggc
atgaaggaatcacagatcagcgcagagattgagctcctgcccaccaatgataagaagaaa
tgggctcggccccccatttccatgaactttgaggtgccatttgcgccttctggcctcaag
gtgcgctacttgaaggtatttgagccgaagctgaactacagcgaccacgatgtcatcaaa
tgggtgcgctacattggccgaagtggcatttacgaaacccgctgctag

DBGET integrated database retrieval system