KEGG   Rattus norvegicus (rat): 116563
Entry
116563            CDS       T01003                                 

Gene name
Ap2m1
Definition
(RefSeq) AP-2 complex subunit mu
  KO
K11826  AP-2 complex subunit mu-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116563 (Ap2m1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    116563 (Ap2m1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116563 (Ap2m1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    116563 (Ap2m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116563 (Ap2m1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    116563 (Ap2m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Other DBs
NCBI-GeneID: 116563
NCBI-ProteinID: NP_446289
RGD: 620135
Ensembl: ENSRNOG00000001709
UniProt: P84092
Structure
PDB: 

Position
11
AA seq 435 aa
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatcggaggcttattcatctataatcacaagggggaggtgcttatctcccgagtctac
agagatgacatcgggaggaatgcagtggatgcctttcgcgtcaatgtcattcacgcacgg
cagcaggtgcgcagccctgtcacaaacatcgctcgcaccagcttcttccatgttaagcgg
tccaacatctggctggcagcagtcaccaagcagaatgtcaatgccgccatggtcttcgaa
ttcctctacaagatgtgtgatgtaatggctgcttactttggcaagatcagcgaggagaac
atcaagaacaatttcgtgctcatatacgagctgctggacgagattctggactttggctac
ccacagaactcagagacaggtgcactgaaaaccttcatcacccaacagggtatcaagagt
cagcatcagacaaaagaagagcagtcccagatcaccagccaggtgaccgggcaaattggc
tggaggcgggaaggcatcaagtatcgtcggaatgaactcttcctagatgttctggagagt
gtgaacctgcttatgtccccacaggggcaggtgctgagtgcccatgtgtcgggccgggtg
gtgatgaagagttacctgagcggcatgcctgagtgcaagtttggaatgaatgacaagatt
gtcatagaaaagcagggcaaaggcacagccgatgaaacaagcaagagtggtaagcagtcg
atcgccattgatgactgcacctttcaccagtgtgtgcgactcagcaagtttgactctgag
cggagcatcagctttatccctcctgatggagagtttgaactcatgagataccgtactacc
aaggacatcatcctgcctttccgggtgatcccattggtgcgggaggtgggacgcaccaaa
ctggaggtcaaggtggtcatcaagtccaacttcaagccctcacttctggcccagaagatt
gaggtgaggatcccaaccccattgaacacaagcggggtgcaagtgatctgcatgaagggg
aaggccaagtacaaggccagcgagaacgccattgtatggaagatcaagcgcatggcaggc
atgaaggaatcacagatcagcgcagagattgagctcctgcccaccaatgataagaagaaa
tgggctcggccccccatttccatgaactttgaggtgccatttgcgccttctggcctcaag
gtgcgctacttgaaggtatttgagccgaagctgaactacagcgaccacgatgtcatcaaa
tgggtgcgctacattggccgaagtggcatttacgaaacccgctgctag

KEGG   Rattus norvegicus (rat): 140670
Entry
140670            CDS       T01003                                 

Gene name
Ap2b1
Definition
(RefSeq) AP-2 complex subunit beta
  KO
K11825  AP-2 complex subunit beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    140670 (Ap2b1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140670 (Ap2b1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    140670 (Ap2b1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    140670 (Ap2b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140670 (Ap2b1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    140670 (Ap2b1)
SSDB
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 RTP1_C1 TIP120 Arm_2 API5 Sec7_N
Other DBs
NCBI-GeneID: 140670
NCBI-ProteinID: NP_542150
RGD: 71048
Ensembl: ENSRNOG00000061543
Vega: OTTRNOG00000000479
UniProt: P62944 Q3ZB97
Structure
PDB: 
3H1Z 3HS9 6OWT

Position
10
AA seq 951 aa
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataagaagggagaaatctttgaattaaaagct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgtgagctctctcttcccagatgtggtgaactgtatgcagact
gacaacctggaactaaagaagcttgtgtacctctatctgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagaccccaatcct
ttgattcgagccttggcagttagaaccatgggatgcatccgggtggacaagattacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagacccctatgttcggaaaaca
gcagcagtatgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaacccaatggtggtggctaatgct
gtagcagcattgtctgagatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaatatcaataagctgctcacagccctgaatgagtgcactgagtggggccagatt
ttcatcttggactgcctgtctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgagtgacgcctcggctctctcatgccaattctgcagtggtgctttcagcagta
aaagttctgatgaagtttctagagttgttacccaaggactctgactactacaatatgctg
ctaaagaagctagcgcctccacttgtcactttgctctctggggagccagaagtgcagtat
gttgccctgaggaacatcaacctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaggtcttctttgtgaagtacaatgatcctatctatgttaaactagagaagttagac
atcatgattcgtcttgcatcccaagccaacattgctcaggttctggcagaactgaaggaa
tatgccactgaagttgatgtggactttgttcgcaaagctgtgagggccattggacggtgt
gccatcaaagtggagcaatcagcagaacgctgtgtgagcacactgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatcttccgaaaa
taccccaacaagtatgagagcattatcgccacgctgtgtgagaacttggactccctggat
gaacccgatgcccgagcggctatgatttggattgtaggagagtatgctgaaagaatcgat
aatgccgatgagttactagagagcttcctggaaggttttcatgatgaaagcacccaggtg
cagctcacgttgcttaccgccatagtgaaactgtttctcaagaagccatcagaaacacag
gagctggtccaacaggtcttgagcttggccacacaggattctgataatcctgaccttcga
gatcggggttatatttattggcgccttctttcaactgaccctgtgacagccaaagaagta
gtgttgtctgagaagccattgatctctgaggaaacagacctcattgaacctaccctcctg
gatgagctcatctgccacattggttctttggcctccgtgtaccataaacctccgaatgct
tttgtggaagggagccatggcattcatcgcaaacacttgccaattcaccatgggagcact
gatgcaggtgatagccctgttggcaccaccactgcaaccaacctggaacagcctcaggtc
atcccctctcaaggtgaccttctgggggatcttttaaatcttgacctgggtcccccagtg
aatgtcccgcaagtgtcctccatgcagatgggagcagtggatcttttaggaggaggactg
gatagcctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtaggacag
tccttcatcccgtcatcagtgcctgcaaccttcgctccttcacctactcctgctgtggtc
agcagtggtctgaatgacctgtttgagctttccactgggataggcatggcacctggcgga
tatgtggctcctaaggcagtctggctacctgctgtaaaggctaaaggcttggagatttcg
gggacgtttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaagct
ctgcagcacatgacggattttgccatccagtttaacaagaatagcttcggtgtcatcccg
agcactcccttggccatacatactccgctgatgccaaaccagagcattgatgtgtctctg
cctctcaacaccttgggcccagtcatgaagatggagcctctgaataacttgcaggtggct
gttaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggaacgccaggtcttccttgcgacgtggaaggatattcccaat
gaaaatgagctccaatttcagattaaggagtgtcatttaaacgctgacacagtttccagc
aagttgcaaaacaacaatgtttacactatcgccaagaggaatgtggaggggcaggacatg
ctgtaccagtccctgaagctcactaatggcatttggattttggcagagctgcggatccag
ccaggaaaccccaattatacgctgtcgctgaagtgtagagcccctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactaa

KEGG   Rattus norvegicus (rat): 308578
Entry
308578            CDS       T01003                                 

Gene name
Ap2a1
Definition
(RefSeq) AP-2 complex subunit alpha-1
  KO
K11824  AP-2 complex subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    308578 (Ap2a1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    308578 (Ap2a1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    308578 (Ap2a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    308578 (Ap2a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308578 (Ap2a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    308578 (Ap2a1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    308578 (Ap2a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   308578 (Ap2a1)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1
Other DBs
NCBI-GeneID: 308578
NCBI-ProteinID: NP_001100981
RGD: 1306254
Ensembl: ENSRNOG00000026243
UniProt: D3ZUY8
Position
1
AA seq 977 aa
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAASALDDSRRDTSSNDINGGVEPTPSNVSTPSPSADL
LGLRAAPPPAAPPAPVGGNLLVDVFSDGPTAQPSLGPTPEEAFLSELEPPAPESPMTLLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNSGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQSFLPTVVHPGDLQTHLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGTAQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgccggctgtatccaaaggcgatggcatgcgtgggcttgccgtgttcatctccgacatc
cggaactgcaagagcaaagaggctgagatcaagaggatcaacaaggaactggccaacatc
cgctccaagttcaaaggggacaaggccttggatggctacagtaaaaagaagtatgtgtgt
aagctgctcttcatcttcctgcttggccatgacattgactttggacacatggaggctgtg
aacctgctaagctccaacaagtacacagagaagcagatagggtacctgttcatctcagtc
ctggtgaactcgaactcagagctgatccggctcattaacaacgctatcaagaacgacctg
gccagtcgcaaccccaccttcatgtgcctggctttgcactgtattgccaacgtgggcagc
cgtgagatgggcgaggcctttgctgccgacattccccgaatcctggtggccggagacagc
atggatagtgtgaagcagagtgcagccctatgcctactgcgtctctacaaggcctccccc
gacttggtgcccatgggcgagtggacggcccgggtggtgcatttgctcaatgatcagcac
atgggagtggtcacagccgctgtcagtctcatcacctgcctgtgcaagaagaatccagat
gacttcaagacctgtgtctccctggctgtgtctcgcctaagccggattgtctcctcagcc
tccactgacctccaggactacacttactacttcgttcctgcaccctggctctctgtgaag
ttactgcggttgctacagtgttacccaccgccagaggatgcggctgtgaaagggcggtta
gtggagtgtcttgagactgtgctcaacaaggcccaggagcctcccaagtccaagaaggtg
cagcactccaatgccaagaacgccatcctgtttgagactattagcctcatcatccactat
gacagtgagcccaacctcctggtccgtgcctgcaaccagctgggccagttcctgcagcac
cgagagacgaacctgcgctacctggctctggagagcatgtgcaccctggccagctccgag
ttctcccacgaggctgtcaagacccacattgatactgttattaatgccctcaagactgag
cgggacgtgagtgtgaggcagcgggcagctgatctgctgtatgccatgtgtgaccggagc
aatgccaagcagattgtatcagagatgctgcggtacctagagacggctgactatgccatc
cgagaggagattgtgctgaaggtggccatcttggctgagaagtatgcagtggactacagc
tggtatgtggacaccatcctcaacctcatccgcattgcaggcgactatgtgagcgaggag
gtgtggtaccgagtgctgcagatcgtcaccaaccgtgatgatgtccagggttatgctgcc
aagacagtgtttgaggccctccaggccccagcctgtcatgagaacatggtgaaggtcggt
ggctacatccttggggagtttgggaacttgattgctggggacccacgctccagcccacct
gtgcagttctcactgctgcactccaagttccacctgtgcagtgtggccactcgtgccttg
ctgctgtccacctacatcaagttcatcaacctcttccctgagaccaaggccaccatccaa
ggtgttcttcgtgccggctcccagctgcgcaatgctgacgtggagctacagcagcgggca
gtggagtacctcaccctcagctctgtagctagcaccgatgttttggctactgtgctagaa
gaaatgcccccatttcctgagcgggagtcatccattttggctaagctgaagcgtaagaag
ggccctggggcagccagtgccctggatgacagccgcagggacaccagcagcaatgacatc
aatgggggtgtggagcccacccccagcaatgtgtcaaccccctcaccctccgcggacctc
ttggggctgcgggcagcccctccccctgctgcacccccagctcctgtaggcgggaacctc
ctggtggatgttttctctgacggccccactgcacagcccagcctgggtcccacccctgag
gaggccttcctcagcgagctggagccccctgcccctgagagccccatgactttgttggct
gacccagctccagctgctgacccaggtcctgaggacataggtcctcccattccagaagca
gatgaactgctgaataagttcgtgtgtaagaatagtggggtcttgtttgagaaccagctg
ctgcagatcggagtcaagtctgagttccggcagaacctgggccgcatgtatctcttctat
ggcaacaagacttctgtgcagttccagagcttcttgcccaccgtggtccaccctggggac
ctccagactcatctggcggtgcagaccaagcgtgtagctgcacaagtggacggtggcgca
caggtgcagcaagtactcaacattgagtgtctgcgagacttcttgacgccaccactgctg
tcggtgcgcttccggtacggtggcaccgcccagtccctcactctgaagctcccagtgacc
atcaacaaattcttccagcccacagagatggccgcccaggactttttccagcgctggaag
cagctgagcctccccctgcaggaggcacagaaaatcttcaaagccaaccaccccatggat
gctgaagtcacaaaggccaagcttctggggtttggctctgctcttctggacaatgtggat
cccaaccctgagaactttgtgggtgctggaatcatccagacgaaagccctgcaggtgggg
tgtctgcttcgactggagcccaatgcccaggcccaaatgtaccgcctaaccctgcgcacc
agcaaagagcctgtgtcccgtcacttatgtgagctgctggcccagcagttctga

KEGG   Rattus norvegicus (rat): 65046
Entry
65046             CDS       T01003                                 

Gene name
Ap2s1
Definition
(RefSeq) AP-2 complex subunit sigma
  KO
K11827  AP-2 complex subunit sigma-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    65046 (Ap2s1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    65046 (Ap2s1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    65046 (Ap2s1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    65046 (Ap2s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65046 (Ap2s1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    65046 (Ap2s1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 65046
NCBI-ProteinID: NP_075241
RGD: 620188
Ensembl: ENSRNOG00000015865
UniProt: P62744
Structure
PDB: 
4NEE 6OWO 6QH7 6OXL 6OWT

Position
1
AA seq 142 aa
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatccgattcattctcatccagaaccgggcaggcaagacacgcctggccaagtggtat
atgcagttcgatgatgacgagaagcagaagttgatcgaggaagtgcacgccgtggtcacc
gtcagggatgccaagcacaccaactttgtggagttccggaacttcaagatcatctaccgg
cgctacgctggcctctacttctgcatctgcgttgacgtcaacgacaacaatctggcctat
cttgaggccatccacaacttcgtagaagtgttaaatgaatacttccacaatgtctgtgaa
ctggacctggtgttcaacttctacaaggtttacacggtggtagatgagatgttcctggca
ggagagatccgagagacgagccagacgaaggtgctgaagcagctgctgatgctgcagtcg
ctggagtga

KEGG   Rattus norvegicus (rat): 81637
Entry
81637             CDS       T01003                                 

Gene name
Ap2a2
Definition
(RefSeq) AP-2 complex subunit alpha-2
  KO
K11824  AP-2 complex subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81637 (Ap2a2)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    81637 (Ap2a2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    81637 (Ap2a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    81637 (Ap2a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81637 (Ap2a2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81637 (Ap2a2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    81637 (Ap2a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   81637 (Ap2a2)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1
Other DBs
NCBI-GeneID: 81637
NCBI-ProteinID: NP_112270
RGD: 71015
Ensembl: ENSRNOG00000019534
UniProt: Q66HM2
Structure
PDB: 

Position
1
AA seq 939 aa
MPAVSKGEGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMGLALHCIANVGSREMAEAFAGEIPKILVAGDTMDSVKQSAALCLLRLYRTSP
DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDPAVRGRLTECLETILNKAQEPPKSKKV
QHSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAQQIVAEMLSYLETADYSI
REEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAA
KTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFNLLHSKFHLCSVPTRAL
LLSTYIKFVNLFPEVKATIQDVLRSDSQLKNADVELQQRAVEYLRLSTVASTDILATVLE
EMPPFPERESSILAKLKKKKGPSTVTDLEETKRERSIDVNGGPEPVPASTSAASTPSPSA
DLLGLGAVPPAPTGPPPTSGGGLLVDVFSDSASAVAPLAPGSEDNFARFVCKNNGVLFEN
QLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDG
GAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQR
WKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQ
IGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
NT seq 2820 nt   +upstreamnt  +downstreamnt
atgccggccgtatccaagggggaggggatgcgaggcctagcggtcttcatctccgatatc
cgtaactgtaaaagtaaagaagctgaaataaagaggataaataaggagctggcaaatatt
agatcaaaatttaaaggtgacaaggctcttgatggctacagtaagaagaagtatgtctgc
aagttactcttcatctttctccttggtcatgacattgactttggacacatggaagctgtg
aatcttctgagctcaaacagatacacggaaaagcagatcggctaccttttcatctctgta
ttggtgaattcaaatagtgaactgatccggttgattaacaatgccatcaagaatgacctg
gccagccgcaatcctacatttatgggtctggccctgcactgcatcgccaatgtgggtagc
cgtgagatggcagaggccttcgctggagagatccccaagatcctggtggcaggagatacc
atggacagtgtgaagcagagcgcagccctgtgcttgttgcgcctgtacaggacgtcacct
gacctagttcctatgggcgactggacatcccgtgtggtacacctcctcaatgaccagcac
ttgggtgtagtgactgccgcaactagcctcatcaccacactggcccagaagaatcctgag
gagttcaagacctctgtctctctagctgtctctcgactgagcagaattgtgacgtccgcg
tcaacagatcttcaggattatacttactactttgtcccggctccttggctgtcagtcaaa
cttctgagactgctgcagtgctacccacccccagaagaccctgcggtgcgtggccgcctg
actgagtgcttggagaccatcctgaataaggcccaggagccccccaagtccaagaaagtc
cagcattcaaatgccaagaacgctgtgctgtttgaggccatcagcctcatcatccaccat
gacagtgagcccaacctcctggtccgtgcctgcaaccagctgggccagttcctgcagcat
cgggagacaaacctgcgctacctggctctggagagcatgtgcacactggccagctctgag
ttctctcacgaggctgtcaagacccacatcgagactgtcatcaatgccttgaagacggaa
cgagatgtgagtgtgcggcagcgggcagtggacctgctctacgccatgtgcgaccgaagc
aacgcccagcagattgtggctgagatgctgagctacctagaaacagctgactactccatc
cgggaggaaattgtgctgaaggtggccatccttgctgagaagtatgcagtggactacact
tggtatgtggacaccatcctcaacctcatccgcattgcaggcgactatgtgagcgaagag
gtgtggtaccgcgtcatccagattgtcatcaatcgcgatgatgtgcagggttatgctgcc
aagacggtgtttgaggcattgcaggctccagcatgtcatgagaacttggtcaaagtgggc
ggctacatcctgggcgagtttggaaacttgatagcgggagacccacgatccagccctctg
atccagttcaacctgctccactccaagttccacttgtgcagcgtccccactcgggcactc
ctgctgtccacctacatcaagttcgtgaacctctttccagaggtaaaggctaccattcag
gacgtgctgcgcagtgacagccaactgaagaacgcagatgtggagctgcagcagcgggct
gtggagtacctgcgactgagtactgttgccagcactgatatcctggcaactgtcctggaa
gaaatgccacccttccctgagcgtgagtcctccatcttggccaagctgaagaagaagaag
ggcccaagcacagtgactgacctggaggagaccaagcgtgagcgaagcatcgatgtgaat
gggggccccgaacccgttccagccagcaccagtgctgcgtccacaccttctccatcagca
gacctgctgggtctgggggccgttccccctgctcccacagggccccctcccacctctggc
ggtgggttactggtggacgtgttctcagactcagcttctgcagttgcacctcttgcaccc
ggctctgaagacaactttgccaggtttgtttgtaaaaacaatggtgtgttgtttgaaaac
cagctgcttcaaattggactgaagtcagaatttcggcagaatttaggtcgaatgttcata
ttttatggtaacaagacctccacgcagttcctaaacttcactccaacactaatctgtgct
gacgaccttcagactaatctgaacctgcagactaagcccgtggacccaactgtggatggg
ggcgcacaggtgcaacaggtggtcaacattgagtgtatatctgatttcacagaggcacct
gtcctcaacatccagttcaggtatggtggtaccttccagaatgtgtctgttaagcttccc
atcactctcaacaaatttttccagcccacagaaatggcttctcaggatttctttcaacgt
tggaagcagttgagcaatccacagcaagaagtgcagaatatcttcaaagcaaagcatccg
atggacacagaaatcactaaagcgaagattattggatttggttctgcgctcctggaagaa
gttgatccaaaccctgcaaattttgtgggtgctggcataatacataccaaaaccacccag
atcggctgcttgttgcgcctggagccaaacctgcaagctcagatgtacagactcaccttg
cgtaccagcaaagacaccgtctctcagagactatgtgaattgctgtcggaacagttctaa

DBGET integrated database retrieval system