KEGG   Rattus norvegicus (rat): 116565Help
Entry
116565            CDS       T01003                                 

Gene name
Lrpap1
Definition
(RefSeq) LDL receptor related protein associated protein 1
  KO
K22290  alpha-2-macroglobulin receptor-associated protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    116565 (Lrpap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-2-MRAP_C Alpha-2-MRAP_N
Motif
Other DBs
NCBI-GeneID: 116565
NCBI-ProteinID: NP_001162584
RGD: 620700
Ensembl: ENSRNOG00000009313
UniProt: Q99068
Position
14q21
AA seq 360 aa AA seqDB search
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME
KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV
ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL
HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR
LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ
LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcttagagacagggtctctacgctgccccggctccaactgctagtgctgttg
ttgctgccgctgctgcttgtgccccagcccatcgcaggtcatggcggcaagtactcgcgg
gagaagaatgagcccgagatggccgccaagcgtgagtccggggaggagttccgcatggag
aagctgaaccagctatgggagaaggccaagcggctgcatctgtctcctgtgaggctggcc
gagctgcattctgacctgaagatacaagagagggatgaactcaactggaagaagctgaag
gtggaaggcctagacggggatggggagaaagaagcaaaactggtccacaatctcaatgtc
atcctggccaggtacggactggatgggaggaaggacacccagacagtgcacagcaacgcc
ctcaatgaagacacccaggatgagctgggggaccccaggttggaaaagctgtggcacaag
gcaaagacatcagggaaattctccagtgaagaactggacaagctgtggcgagagtttctg
cactacaaagagaagatccacgagtacaatgtactgctagatacactgagcagagctgaa
gaaggttatgagaaccttctcagcccctctgacatgacccacatcaagagtgacaccctg
gccagcaagcacagtgaactgaaggacagactgcgtagtatcaaccagggcctagaccgc
ctgaggaaggtcagccaccagggctacggccccgccactgagtttgaagagccccgagtg
atagatctgtgggacctggctcagtctgccaacttcaccgagaaggaactggagtcgttc
agggaggagcttaagcacttcgaggccaaaatcgaaaagcacaaccactaccagaagcag
ctggagatttcccaccagaagctgaagcacgtggagagcatcggtgaccccgagcacatc
agccgcaacaaggagaagtacgtcctgctggaggagaagacaaaggagctgggctacaag
gtgaagaagcatctgcaggacctgtccagcagggtctcaagggctcggcacaatgagctc
tga

DBGET integrated database retrieval system