KEGG   Rattus norvegicus (rat): 116568
Entry
116568            CDS       T01003                                 

Gene name
Ggt1, GGLUT, Ggt, Ggtp
Definition
(RefSeq) gamma-glutamyltransferase 1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00430  Taurine and hypotaurine metabolism
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    116568 (Ggt1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    116568 (Ggt1)
   00480 Glutathione metabolism
    116568 (Ggt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    116568 (Ggt1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    116568 (Ggt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     116568 (Ggt1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     116568 (Ggt1)
    3.4.19.14  leukotriene-C4 hydrolase
     116568 (Ggt1)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   116568 (Ggt1)
CD molecules [BR:rno04090]
 Proteins
  116568 (Ggt1)
SSDB
Motif
Pfam: G_glu_transpept Mqo
Other DBs
NCBI-GeneID: 116568
NCBI-ProteinID: NP_446292
RGD: 2683
UniProt: P07314
Position
20p12
AA seq 568 aa
MKNRFLVLGLVAVVLVFVIIGLCIWLPTTSGKPDHVYSRAAVATDAKRCSEIGRDMLQEG
GSVVDAAIASLLCMGLINAHSMGIGGGLFFTIYNSTTRKAEVINAREMAPRLANTSMFNN
SKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLARALDKK
RDIIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGARAFYNGSLTAQIVKDI
QEAGGIMTVEDLNNYRAEVIEHPMSIGLGDSTLYVPSAPLSGPVLILILNILKGYNFSPK
SVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQVIRNMSSEFYATQLRARITDE
TTHPTAYYEPEFYLPDDGGTAHLSVVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEM
DDFSSPNFTNQFGVAPSPANFIKPGKQPLSSMCPSIIVDKDGKVRMVVGASGGTQITTSV
ALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKNIDQVVTAGLKTRHHHTEVTPDFI
AVVQAVVRTSGGWAAASDSRKGGEPAGY
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgaagaatcggtttctggtgctgggcctggtggcggtggttctggtgttcgtcatcatc
ggcctctgcatctggctacccaccacctctgggaagcctgaccatgtgtactccagggcg
gccgtggccacagatgccaagcgttgctcagagattgggcgggatatgctacaggaaggc
ggctccgtagtggacgcggccatcgcaagcctgctgtgtatggggctcattaatgcccac
agtatgggcatcgggggcggcctcttcttcaccatctacaacagcaccacacgaaaagct
gaagttatcaatgcccgtgaaatggctcccaggttggccaataccagcatgttcaataat
tctaaggactctgaagaaggaggcctttcagtggcagttcctggtgaaatccgtggctat
gagctggcacaccaacggcatggccggctaccctgggctcgcctcttccaacccagcatc
caactggctcgccatggcttccctgtgggcaagggcttggcaagagccctggacaaaaaa
cgggacatcattgagaagacacctgctttgtgcgaggtgttctgccggcaagggaaggtg
cttcaggaaggagagacagtaactatgccgaagttggccgatacgttgcaaatactggcc
caggaaggggccagggccttctacaatgggagcctcacagcccagattgtgaaagacatc
caggaggctgggggcattatgacggttgaggaccttaacaactatcgtgcggaagtgatc
gagcatccgatgagcatcggcctcggggactccaccctgtacgtgcccagcgccccactc
agcgggcccgtgctgattctcatcttgaacatcctcaaaggatacaacttctctccaaag
agcgtggcaaccccagaacagaaggcgctgacgtatcaccgtatcgtggaggcctttcgg
tttgcctatgccaagaggaccatgctcggtgacccaaagtttgtcgatgtgtctcaggtc
atccgcaacatgagttctgagttctacgctactcagcttcgagcccgcatcactgatgaa
accactcacccaaccgcctactatgagcctgaattctaccttccagacgatgggggtacc
gctcacctgtccgtggtttccgaggatggcagtgctgtggccgccaccagtaccatcaac
ctctactttggctccaaggtcctctctcgggtcagtggcatcctgtttaatgacgagatg
gatgacttcagctcgcccaacttcaccaaccagtttggggtagcgccctcaccagccaac
ttcatcaagccaggtaagcaaccgctttcatccatgtgcccctcaatcatcgtggataag
gacggcaaggttcggatggtggttggagcctcgggaggtacccagatcaccacgtctgtt
gcactggccatcatcaacagcctgtggttcgggtatgatgtgaagagagctgtggaggag
ccccgtcttcacaaccagcttttgcccaataccacaacagtagagaaaaatattgatcag
gtggtgactgcaggtctgaagactcggcaccaccatacagaggtcacacccgacttcatc
gctgtggttcaggccgtcgttcgaacgtcaggtggttgggcagctgcctcagattccaga
aaaggcggggagcccgctggctactga

DBGET integrated database retrieval system