KEGG   Rattus norvegicus (rat): 116568
Entry
116568            CDS       T01003                                 

Gene name
Ggt1
Definition
(RefSeq) glutathione hydrolase 1 proenzyme
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00430  Taurine and hypotaurine metabolism
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    116568 (Ggt1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    116568 (Ggt1)
   00480 Glutathione metabolism
    116568 (Ggt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    116568 (Ggt1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    116568 (Ggt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     116568 (Ggt1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     116568 (Ggt1)
    3.4.19.14  leukotriene-C4 hydrolase
     116568 (Ggt1)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   116568 (Ggt1)
CD molecules [BR:rno04090]
 Proteins
  116568 (Ggt1)
SSDB
Motif
Pfam: G_glu_transpept Mqo
Other DBs
NCBI-GeneID: 116568
NCBI-ProteinID: NP_446292
RGD: 2683
UniProt: P07314
Position
20
AA seq 568 aa
MKNRFLVLGLVAVVLVFVIIGLCIWLPTTSGKPDHVYSRAAVATDAKRCSEIGRDMLQEG
GSVVDAAIASLLCMGLINAHSMGIGGGLFFTIYNSTTRKAEVINAREMAPRLANTSMFNN
SKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLARALDKK
RDIIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGARAFYNGSLTAQIVKDI
QEAGGIMTVEDLNNYRAEVIEHPMSIGLGDSTLYVPSAPLSGPVLILILNILKGYNFSPK
SVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQVIRNMSSEFYATQLRARITDE
TTHPTAYYEPEFYLPDDGGTAHLSVVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEM
DDFSSPNFTNQFGVAPSPANFIKPGKQPLSSMCPSIIVDKDGKVRMVVGASGGTQITTSV
ALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKNIDQVVTAGLKTRHHHTEVTPDFI
AVVQAVVRTSGGWAAASDSRKGGEPAGY
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgaagaatcggtttctggtgctgggcctggtggcggtggttctggtgttcgtcatcatc
ggcctctgcatctggctacccaccacctctgggaagcctgaccatgtgtactccagggcg
gccgtggccacagatgccaagcgttgctcagagattgggcgggatatgctacaggaaggc
ggctccgtagtggacgcggccatcgcaagcctgctgtgtatggggctcattaatgcccac
agtatgggcatcgggggcggcctcttcttcaccatctacaacagcaccacacgaaaagct
gaagttatcaatgcccgtgaaatggctcccaggttggccaataccagcatgttcaataat
tctaaggactctgaagaaggaggcctttcagtggcagttcctggtgaaatccgtggctat
gagctggcacaccaacggcatggccggctaccctgggctcgcctcttccaacccagcatc
caactggctcgccatggcttccctgtgggcaagggcttggcaagagccctggacaaaaaa
cgggacatcattgagaagacacctgctttgtgcgaggtgttctgccggcaagggaaggtg
cttcaggaaggagagacagtaactatgccgaagttggccgatacgttgcaaatactggcc
caggaaggggccagggccttctacaatgggagcctcacagcccagattgtgaaagacatc
caggaggctgggggcattatgacggttgaggaccttaacaactatcgtgcggaagtgatc
gagcatccgatgagcatcggcctcggggactccaccctgtacgtgcccagcgccccactc
agcgggcccgtgctgattctcatcttgaacatcctcaaaggatacaacttctctccaaag
agcgtggcaaccccagaacagaaggcgctgacgtatcaccgtatcgtggaggcctttcgg
tttgcctatgccaagaggaccatgctcggtgacccaaagtttgtcgatgtgtctcaggtc
atccgcaacatgagttctgagttctacgctactcagcttcgagcccgcatcactgatgaa
accactcacccaaccgcctactatgagcctgaattctaccttccagacgatgggggtacc
gctcacctgtccgtggtttccgaggatggcagtgctgtggccgccaccagtaccatcaac
ctctactttggctccaaggtcctctctcgggtcagtggcatcctgtttaatgacgagatg
gatgacttcagctcgcccaacttcaccaaccagtttggggtagcgccctcaccagccaac
ttcatcaagccaggtaagcaaccgctttcatccatgtgcccctcaatcatcgtggataag
gacggcaaggttcggatggtggttggagcctcgggaggtacccagatcaccacgtctgtt
gcactggccatcatcaacagcctgtggttcgggtatgatgtgaagagagctgtggaggag
ccccgtcttcacaaccagcttttgcccaataccacaacagtagagaaaaatattgatcag
gtggtgactgcaggtctgaagactcggcaccaccatacagaggtcacacccgacttcatc
gctgtggttcaggccgtcgttcgaacgtcaggtggttgggcagctgcctcagattccaga
aaaggcggggagcccgctggctactga

KEGG   Rattus norvegicus (rat): 156275
Entry
156275            CDS       T01003                                 

Gene name
Ggt7
Definition
(RefSeq) glutathione hydrolase 7
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00430  Taurine and hypotaurine metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    156275 (Ggt7)
   00480 Glutathione metabolism
    156275 (Ggt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    156275 (Ggt7)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     156275 (Ggt7)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     156275 (Ggt7)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   156275 (Ggt7)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 156275
NCBI-ProteinID: NP_569107
RGD: 619870
Ensembl: ENSRNOG00000018441
UniProt: Q99MZ4
Position
3
AA seq 662 aa
MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDS
FLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATG
VTVALVMQIYFGDPQIFQQGAVVTDASCCTALGMEVLSKQGSSVDAAVAAALCLGIVAPH
SSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKPGLLVGVPGMVKGLY
EAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLETFLPLGHPPL
PGSLLRRPDLAEVLDILGISGPAAFYNGGNLTLEMVAEVQHAGGVMTEEDFSNYSALTEK
PVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALAS
RLGDPVYDSTISESMDDMLSKVEAANFRGHISDSQAAPAPLLPVYELDGAPTAAQVLVMG
PDDFIVAMVSSLNRPFGSGLLTPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPL
SFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDL
QSNVLQVDSEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIGVKDPRSLDATGAS
IL
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggcggcagagaacgaggctagccaggagagcgccctaggcgcctactcaccagtagac
tacatgagcatcaccagcttcccgaggctgcccgaggacgagccagcgcctgcggccccg
ctgaggggccgtaaggacgaggatgccttcctgggagacccggatactgatccggactcc
ttcctgaagtctgcccggcttcagcgattgccttcatcttcctcggagatgggcagccag
gacgggtcaccacttcgcgagacgcgcaaggacccattctcagctgcagcagccgagtgt
tcctgccgccaggacgggctcacggtcatcgtcaccgcctgcctcacttttgccacgggt
gttaccgtggcgctggtcatgcaaatctacttcggggatccccagatcttccagcaaggt
gctgtggtgacggatgcctcctgttgcacggcgctgggcatggaggtgctcagtaaacag
ggctcttccgtggacgcagctgtggcagcagccttgtgtttgggaatagtggctccacac
agttctggcctgggcgggggaggcgtgatgctggtacacgatatccgccggaatgagagc
cacctaattgatttccgggagtctgcacctggggccctcagagaagaggccctgcagaga
tcctgggataccaagcctgggctcttggtgggggtccccggaatggtgaaagggctatat
gaagctcatcaactctatggcaggctgccctggtcccaagtcctggccttcgcagcagct
gtggcccaagatggcttcaacgtgacccatgatctagctcatgccttggctgagcagctg
cctcccaatgcatctgaccgcttcctggaaactttcctgccgttgggccacccacctttg
cctggctccctgctgagacggcctgatctcgccgaggtgctggatatacttggcatctct
ggccctgctgccttctacaatggtggcaacctcacgctggagatggtggctgaggttcag
catgcagggggtgtcatgaccgaggaggacttcagcaactatagtgctctcacggagaag
cctgtgtgtggagtataccgaggccacctggttctcagtcccccacccccacacacaggc
ccggccctcatcagtgcgctcaacatcctggagggcttcaacctcaccagcctggtatcc
cgcgagcaagcgcttcactgggtagcagagaccctgaagattgcattggccctggctagc
agactgggagaccctgtctatgattctaccatcagtgagagcatggacgacatgctcagc
aaggtggaggctgccaacttccggggccacatcagtgactctcaggcagcccctgcccca
ctcctgcctgtctatgagctggacggggctcccacagctgcccaggtgctggtcatgggc
cctgacgacttcatcgtggccatggtcagctccctgaatcggccttttggaagtggcctc
ctcactccctccgggatccttctcaacagccagatgctagacttctcctggcccaatagg
actgctaaccactctgcacccagcctggagaactcggtacagccagggaagcggcccctc
tctttccttctgcccactgtagtccgaccagcagaagggctctgtgggacctacctcgct
ctgggggccaacggagctgctcgaggcctcagtggcctgacccaggttctactgaatgtc
ctgaccttgaatcggaacctgagtgacagcctggccagaggacgcctccacccagacctg
cagtccaacgtcctgcaggtggacagtgagttcaccgaggaagagattgagttcctggaa
gccaggggtcaccatgtggagaaggtagatgtcttatcctgggtccacggcagtcggaga
accaacaacttcatcattggtgtgaaggaccctcggagcctggatgcaaccggagccagc
atcctgtag

KEGG   Rattus norvegicus (rat): 29566
Entry
29566             CDS       T01003                                 

Gene name
Ggt5
Definition
(RefSeq) glutathione hydrolase 5 proenzyme
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00430  Taurine and hypotaurine metabolism
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    29566 (Ggt5)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    29566 (Ggt5)
   00480 Glutathione metabolism
    29566 (Ggt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29566 (Ggt5)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    29566 (Ggt5)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     29566 (Ggt5)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     29566 (Ggt5)
    3.4.19.14  leukotriene-C4 hydrolase
     29566 (Ggt5)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   29566 (Ggt5)
CD molecules [BR:rno04090]
 Proteins
  29566 (Ggt5)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 29566
NCBI-ProteinID: NP_062108
RGD: 2684
UniProt: Q9QWE9
Position
20
AA seq 572 aa
MAWGHRTTVCLVLLGVSLGLAIIVLAVVLPHHQASCRPDAFTRAAVAADSKICSDIGRVI
LQQQGSPVDAAIAALICTGVVNPQSMGLGGGVVFTIYNASTGKVEVINARETVPASHDQR
LLDQCTNALPLCTGAQWIGVPGELRGYAEAHRRYGRLPWAQLFQPTIALLREGFRVPPIL
SQFLNTSFLQPCLNSSTLRQLFFNGTETLRSQDPLPWPALANTLETVAKEGAEVLYTGKL
GQTLVEDIAWQGSQLTVQDLAAFRPKVVEPLEMALGNYTLYSPPPPAGGAILSFILNVLK
GFNFSAETVAGPEGKVNMYHHLVEALKFAVGQRWRLWDPYSHPGIQNISQDLLRETLAQH
IRQQIDGRGDHQLSHYNLSGVRGNSMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT
GILLNNELLDLCWRHKPGSTVTPPPVPGEQPPSSMVPSILINEVQGSKLVIGGAGGELII
SAVTQAIVNKLWLGFSLTDAIAAPILHVNSKGHVEYEPKFNQEVRKGLQDRGQSQSQSQR
PVFLNSVQAVFQEGPCVYAASDLRKAGKASGY
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggcatggggccataggaccacagtctgcctggtcctgctgggtgtgagtctgggtctg
gccatcattgtgctggctgtggtccttcctcatcaccaagcctcttgccgtcccgatgcc
ttcactcgtgctgccgtagctgctgattctaagatctgctcagatattggacgagtcatc
ctccagcagcagggctcacctgtggacgccgccattgctgccctcatctgtaccggtgtt
gttaaccctcagagcatgggcctgggcggaggggtcgtcttcaccatctacaatgcatct
acagggaaggtggaggtcatcaatgctcgggagacagtgccagccagccatgaccagaga
ctgctagaccagtgtacaaatgccctgccactgtgcacaggggcccagtggatcggggtt
cctggtgagctccgcggctatgctgaggcgcaccgccgatacggccgcctgccttgggct
cagcttttccagcccaccattgccctgctccgagagggtttccgtgtgccccctatcctc
agtcagttcctcaacaccagcttcctgcagccctgcttgaattcatcaaccctgagacag
ctcttcttcaatgggacagaaaccttgagatctcaggacccactcccatggcctgcgctg
gccaacaccttggagactgtggctaaggagggtgcagaggtcttatacaccggaaagctg
ggacaaacgctggtggaagacattgcctggcaaggaagccagctgacggttcaggacttg
gctgccttccggccgaaagtggtggaacccctggagatggccctaggaaactataccctg
tactctccaccgccgccggcagggggcgctattcttagcttcattctcaacgtgctgaaa
gggttcaacttctctgcagagacggtggccgggcctgaagggaaggtgaacatgtaccac
caccttgtagaggctctcaagttcgcagtagggcagaggtggcggctatgggacccctac
agccacccagggatacagaacatctcccaggaccttctccgggagactctagcccagcac
atccgccagcagattgatggccgtggtgaccaccagctcagccattacaacctgtccggg
gtcaggggcaacagcatgggcacgtctcatgtgtctgtgttgggagaagacggcagcgct
gtggcagccaccagcaccatcaacacaccctttggagcgatggtgtactccccacggaca
ggcatcctcctcaacaacgagctactagacttatgctggagacacaagccaggttcaacg
gtcacccctccccctgttccaggtgagcagccaccatcatccatggtaccctccatcttg
atcaacgaagtccaggggtcgaagctggtgatcggtggggctggtggggagcttatcatc
tctgctgtgacccaggctatcgtgaataagctgtggcttggctttagcctgacagacgcc
atcgcagcgcccatcctacatgtgaatagcaagggccacgtggaatatgagcccaagttt
aaccaggaggttcggaaggggctacaggaccgaggccagagccagagccagagccagagg
ccggttttcctgaattcggtccaggctgtgtttcaggaagggccctgtgtctatgcagca
tctgacctgaggaaggctggaaaggcttcaggatactaa

KEGG   Rattus norvegicus (rat): 408206
Entry
408206            CDS       T01003                                 

Gene name
Ggt6
Definition
(RefSeq) glutathione hydrolase 6
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00430  Taurine and hypotaurine metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    408206 (Ggt6)
   00480 Glutathione metabolism
    408206 (Ggt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    408206 (Ggt6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     408206 (Ggt6)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     408206 (Ggt6)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   408206 (Ggt6)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 408206
NCBI-ProteinID: NP_001002820
RGD: 1303335
Ensembl: ENSRNOG00000015210
UniProt: Q6IE08
Position
10
AA seq 498 aa
MDATTGAVLYQKLQLWEPGMESEEEEEEEEIAEPLVLSLRRLQNTPGNKVGGLPGAWTRL
LAGLLLLAVSSSLALRQLQGRNSPKGNLGPVDLPASRHSHHPGVYHHSAVISPAATCSRL
GQELLVAGGNVVDAGVGAALCLAVVHPHATGLGATFWGLFYNSSSGNSTALTAGPAQILA
PGLGLPTALPALHLLHTHFGRLPWSHLLAKPAMLAQKGFEVDAPLASALAAQGTEGLCPL
FCHTNGTPLGLGAQVTNPNLAAVLLREALASSPDLVGNALLNLLVRDLGLELPSVQPKPS
LEPALQLLLPQGVLFTTPGPSAGPELMGLLESTLHSKTPSPASCSSLLQTAETPVSSALA
TVDSHGSMLLLTSSLNSSFGSGHLSPSTGVLLSNLEASSVPSTWACPLILRGNLDDTEDD
MLGLVASGIPRGAKAMACTLFNHLTTPQTQQQVQHQAQQRPTESPGICGKEALLQVVVHA
EHAQVSSIPSGCCPFQGY
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggatgccaccacaggggctgtgctctaccagaagctgcaactctgggagcctggcatg
gagtcagaggaggaggaagaagaggaagaaatagcagaaccactagtcctttccctaagg
agactccaaaatacccccgggaacaaggttggtgggttgccaggagcctggacccgcctg
ctggcaggcctgctgctgctggctgttagcagctccctggctctgaggcagctgcaaggt
aggaacagcccaaaaggaaacttgggccctgtggatcttccagccagcagacactcccac
caccctggtgtgtaccaccacagcgctgtcatcagccctgcagccacatgttcccgactg
ggccaagagctgcttgtcgctgggggcaatgtcgtggatgctggagttggagcagctttg
tgtctggcggtggtgcatcctcatgcaacagggctaggtgccacattctggggtctcttc
tacaatagctcctcaggaaactcaactgccctgacagcaggtccagcccaaatcctggcc
cctggcctgggactgcccacagctctgcctgccctgcatttgcttcatacccacttcggc
cgcctgccctggtcacacctgctggccaagcctgccatgctggctcaaaagggctttgag
gtagatgcacccctggcaagcgcactagcagcccagggtacagaggggctctgtccactg
ttctgccataccaacggaaccccactgggtcttggggctcaagtcaccaaccccaacctg
gcagctgtgttgctccgtgaagccctggcctccagcccagatcttgttgggaatgccttg
ctgaacctgctggtcagagacctggggttagagttgccctctgtgcagcccaagccttcc
ttagagcctgcactgcagcttcttctgcctcagggtgtgctgttcactactcctggcccc
tcagcaggcccagaacttatgggactgttggagtctactcttcactccaagacacccagc
cctgcttcctgctcatcactcctgcagactgctgaaaccccagtgagcagtgccctggcc
actgtggacagccatggctccatgctccttctaacctcctcactcaacagctcctttggc
tctggacatctgtccccaagtactggcgttcttctcagcaacctggaagccagctctgta
cctagtacctgggcctgtccactcattctccgtggcaacctagatgacacagaagacgat
atgttggggctggtggcttcagggatccccagaggggccaaagccatggcttgcaccttg
ttcaatcatctgacaacaccccaaacccaacagcaggtccaacatcaagcccaacaaaga
cccacagaaagccctggcatttgtggcaaagaggctctactgcaggtagtagtccatgca
gaacacgcccaggtctccagcatccctagtggctgctgcccctttcaggggtattaa

DBGET integrated database retrieval system