KEGG   Rattus norvegicus (rat): 116589Help
Entry
116589            CDS       T01003                                 

Gene name
Serpinb5, Maspin, PI-5, Pi5
Definition
(RefSeq) serpin family B member 5
  KO
K10139  serpin B5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    116589 (Serpinb5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    116589 (Serpinb5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    116589 (Serpinb5)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   116589 (Serpinb5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 116589
NCBI-ProteinID: NP_476449
RGD: 69342
Ensembl: ENSRNOG00000002640
UniProt: P70564
Position
13p11
AA seq 375 aa AA seqDB search
MDALRLANSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
ENVKDVPFGFKPITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVD
FKDKLEETKGQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESET
KECPFRINKTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDES
TGLEKIEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES
TSDFSGMSETKGVSVSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEFKADHPFLFIVRH
NKTRNIVFLGKFSSP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttgagactggcaaattcagcttttgctgttgaattgttcaaacaactatgt
gaaaaggagccagcaggaaacattctcttctctccgatatgcctctccacttctctgtcc
cttgctcaagtaggcgccaaaggtgacacggcaaatgaaattggacaggtccttcatttt
gagaatgttaaagatgtaccctttggtttcaaaccaatcacttctgatgttaataagctc
agttccttttattcgctgaaactaatcaagcgactatacattgacaaatctctgaacctt
tctacagaatttatcagttctacaaaaagaccatatgccaacgaattggaaactgttgac
ttcaaagataaactggaagagacgaaaggtcaaattaacagctccattaaggaactcaca
gacggccactttgaagatattttgccagagaacagtataagtgaccagaccaaaatcctt
gtggttaatgctgcctactttgttggaaagtggatgaagaaatttccagaatcagaaaca
aaagaatgtccattcagaatcaacaagacagacaccaaaccagtacaaatgatgaatctt
gaggctaccttctgcttgggtaacattgatgacatcaactgtaagatcatagaacttcct
ttccagaataagcatctcagtatgctcattgtgctccctaaggacgtggaagatgaatcc
acaggcctggagaagattgaaaaacaactcaacccagaaacactgttacagtggaccaac
cccagcaccatggccaatgccaaagtcaagctttcccttccaaagtttaaggtagaaaag
atgattgaccccaaggctagtctggaaagcctagggctgaaaagtctcttcaatgaaagt
acatcggatttctctggaatgtcagagaccaagggagtgtccgtatcaaatgtgattcac
agagtatgcctagaaataactgaagatggtggtgattccatcgaggtgccagggtcccgg
atcttacagcacaaggatgaattcaaagctgaccatccatttctttttatcgttcgacac
aacaaaactcgaaacatcgttttcttgggcaaattctcttctccttag

DBGET integrated database retrieval system