KEGG   Rattus norvegicus (rat): 116590Help
Entry
116590            CDS       T01003                                 

Gene name
Mapk1, ERK-2, ERT1, Erk2, p42-MAPK
Definition
(RefSeq) mitogen activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04520  Adherens junction
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04930  Type II diabetes mellitus
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing's syndrome
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer's disease
rno05020  Prion diseases
rno05034  Alcoholism
rno05132  Salmonella infection
rno05133  Pertussis
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Module
rno_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    116590 (Mapk1)
   04015 Rap1 signaling pathway
    116590 (Mapk1)
   04010 MAPK signaling pathway
    116590 (Mapk1)
   04012 ErbB signaling pathway
    116590 (Mapk1)
   04350 TGF-beta signaling pathway
    116590 (Mapk1)
   04370 VEGF signaling pathway
    116590 (Mapk1)
   04371 Apelin signaling pathway
    116590 (Mapk1)
   04668 TNF signaling pathway
    116590 (Mapk1)
   04066 HIF-1 signaling pathway
    116590 (Mapk1)
   04068 FoxO signaling pathway
    116590 (Mapk1)
   04072 Phospholipase D signaling pathway
    116590 (Mapk1)
   04071 Sphingolipid signaling pathway
    116590 (Mapk1)
   04024 cAMP signaling pathway
    116590 (Mapk1)
   04022 cGMP - PKG signaling pathway
    116590 (Mapk1)
   04151 PI3K-Akt signaling pathway
    116590 (Mapk1)
   04150 mTOR signaling pathway
    116590 (Mapk1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    116590 (Mapk1)
  Cell growth and death
   04114 Oocyte meiosis
    116590 (Mapk1)
   04210 Apoptosis
    116590 (Mapk1)
   04218 Cellular senescence
    116590 (Mapk1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    116590 (Mapk1)
   04520 Adherens junction
    116590 (Mapk1)
   04540 Gap junction
    116590 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    116590 (Mapk1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    116590 (Mapk1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    116590 (Mapk1)
   04620 Toll-like receptor signaling pathway
    116590 (Mapk1)
   04621 NOD-like receptor signaling pathway
    116590 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    116590 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    116590 (Mapk1)
   04660 T cell receptor signaling pathway
    116590 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    116590 (Mapk1)
   04659 Th17 cell differentiation
    116590 (Mapk1)
   04657 IL-17 signaling pathway
    116590 (Mapk1)
   04662 B cell receptor signaling pathway
    116590 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    116590 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    116590 (Mapk1)
   04062 Chemokine signaling pathway
    116590 (Mapk1)
  Endocrine system
   04910 Insulin signaling pathway
    116590 (Mapk1)
   04912 GnRH signaling pathway
    116590 (Mapk1)
   04915 Estrogen signaling pathway
    116590 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    116590 (Mapk1)
   04917 Prolactin signaling pathway
    116590 (Mapk1)
   04921 Oxytocin signaling pathway
    116590 (Mapk1)
   04926 Relaxin signaling pathway
    116590 (Mapk1)
   04919 Thyroid hormone signaling pathway
    116590 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    116590 (Mapk1)
   04916 Melanogenesis
    116590 (Mapk1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    116590 (Mapk1)
   04270 Vascular smooth muscle contraction
    116590 (Mapk1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    116590 (Mapk1)
  Nervous system
   04724 Glutamatergic synapse
    116590 (Mapk1)
   04725 Cholinergic synapse
    116590 (Mapk1)
   04726 Serotonergic synapse
    116590 (Mapk1)
   04720 Long-term potentiation
    116590 (Mapk1)
   04730 Long-term depression
    116590 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    116590 (Mapk1)
   04722 Neurotrophin signaling pathway
    116590 (Mapk1)
  Development
   04360 Axon guidance
    116590 (Mapk1)
   04380 Osteoclast differentiation
    116590 (Mapk1)
  Environmental adaptation
   04713 Circadian entrainment
    116590 (Mapk1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    116590 (Mapk1)
   05230 Central carbon metabolism in cancer
    116590 (Mapk1)
   05231 Choline metabolism in cancer
    116590 (Mapk1)
   05205 Proteoglycans in cancer
    116590 (Mapk1)
   05203 Viral carcinogenesis
    116590 (Mapk1)
   05210 Colorectal cancer
    116590 (Mapk1)
   05212 Pancreatic cancer
    116590 (Mapk1)
   05225 Hepatocellular carcinoma
    116590 (Mapk1)
   05226 Gastric cancer
    116590 (Mapk1)
   05214 Glioma
    116590 (Mapk1)
   05216 Thyroid cancer
    116590 (Mapk1)
   05221 Acute myeloid leukemia
    116590 (Mapk1)
   05220 Chronic myeloid leukemia
    116590 (Mapk1)
   05218 Melanoma
    116590 (Mapk1)
   05211 Renal cell carcinoma
    116590 (Mapk1)
   05219 Bladder cancer
    116590 (Mapk1)
   05215 Prostate cancer
    116590 (Mapk1)
   05213 Endometrial cancer
    116590 (Mapk1)
   05224 Breast cancer
    116590 (Mapk1)
   05223 Non-small cell lung cancer
    116590 (Mapk1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    116590 (Mapk1)
   05020 Prion diseases
    116590 (Mapk1)
  Substance dependence
   05034 Alcoholism
    116590 (Mapk1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    116590 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    116590 (Mapk1)
   04934 Cushing's syndrome
    116590 (Mapk1)
  Infectious diseases
   05132 Salmonella infection
    116590 (Mapk1)
   05133 Pertussis
    116590 (Mapk1)
   05152 Tuberculosis
    116590 (Mapk1)
   05164 Influenza A
    116590 (Mapk1)
   05161 Hepatitis B
    116590 (Mapk1)
   05160 Hepatitis C
    116590 (Mapk1)
   05163 Human cytomegalovirus infection
    116590 (Mapk1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    116590 (Mapk1)
   05165 Human papillomavirus infection
    116590 (Mapk1)
   05145 Toxoplasmosis
    116590 (Mapk1)
   05140 Leishmaniasis
    116590 (Mapk1)
   05142 Chagas disease (American trypanosomiasis)
    116590 (Mapk1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    116590 (Mapk1)
   01524 Platinum drug resistance
    116590 (Mapk1)
   01522 Endocrine resistance
    116590 (Mapk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     116590 (Mapk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   116590 (Mapk1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     116590 (Mapk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116590 (Mapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 116590
NCBI-ProteinID: NP_446294
RGD: 70500
Ensembl: ENSRNOG00000001849
UniProt: P63086
Structure
PDB: 

Position
11q23
AA seq 358 aa AA seqDB search
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtgggg
ccgcgctacactaatctctcgtacatcggagaaggcgcctacggcatggtttgttctgct
tatgataatctcaacaaagttcgagttgctatcaagaaaatcagtccttttgagcaccag
acctactgtcagagaaccctgagagagataaaaatcctactgcgcttcagacatgagaac
atcatcggcatcaatgacatcatccgggcaccaaccattgagcagatgaaagatgtatat
atagtacaggacctcatggagacagatctttacaagctcttgaagacacagcacctcagc
aatgatcatatctgctattttctttatcagatcctgagaggattaaagtatatacattca
gctaatgttctgcaccgtgacctcaagccttccaacctcctgctgaacaccacttgtgat
ctcaagatctgtgactttggccttgcccgtgttgcagatccagaccatgatcatacaggg
ttcttgacagagtatgtagccacgcgttggtacagagctccagaaattatgttgaattcc
aagggttataccaagtccattgatatttggtctgtgggctgcatcctggcagagatgcta
tccaacaggcctatcttcccaggaaagcattaccttgaccagctgaatcacatcctgggt
attcttggatctccatcacaggaagatctgaattgtataataaatttaaaagctagaaac
tatttgctttctctcccgcacaaaaataaggtgccgtggaacaggttgttcccaaacgct
gactccaaagctctggatttactggataaaatgttgacatttaaccctcacaagaggatt
gaagttgaacaggctctggcccacccgtacctggagcagtattatgacccaagtgatgag
cccattgctgaagcaccattcaagtttgacatggagctggacgacttacctaaggagaag
ctcaaagaactcatttttgaagagactgctcgattccagccaggatacagatcttaa

DBGET integrated database retrieval system