KEGG   Rattus norvegicus (rat): 116591
Entry
116591            CDS       T01003                                 

Gene name
Fcgr2a, Fcgr3, Fcgr3a
Definition
(RefSeq) Fc fragment of IgG, low affinity IIa, receptor
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04666  Fc gamma R-mediated phagocytosis
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116591 (Fcgr2a)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    116591 (Fcgr2a)
   04650 Natural killer cell mediated cytotoxicity
    116591 (Fcgr2a)
   04666 Fc gamma R-mediated phagocytosis
    116591 (Fcgr2a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    116591 (Fcgr2a)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    116591 (Fcgr2a)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    116591 (Fcgr2a)
   05152 Tuberculosis
    116591 (Fcgr2a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    116591 (Fcgr2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116591 (Fcgr2a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    116591 (Fcgr2a)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    116591 (Fcgr2a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    116591 (Fcgr2a)
CD molecules [BR:rno04090]
 Proteins
  116591 (Fcgr2a)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  116591 (Fcgr2a)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 Ig_5
Other DBs
NCBI-GeneID: 116591
NCBI-ProteinID: NP_446295
RGD: 71069
Ensembl: ENSRNOG00000046663
UniProt: P27645 M0R4F7
Position
13q24
AA seq 267 aa
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVI
SDWLLLQTPQLVFLEGERITLRCHGWKSIQLARISFLQNGEFVSFHPYNVSYSISNANHS
HSGDYYCKAYLGRTEHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRRSLSVGKYKAPQDK
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccgtacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttctggaaggagaaagaatcaca
ttgaggtgtcacggctggaagagcatacagctggccaggatttcattcctccagaatgga
gaatttgtgtcatttcatccttataatgttagctactccatctcaaacgccaaccacagt
cacagtggggactactactgcaaagcatatctaggaaggacagaacacgtgtccaagcct
gtcaccatcactgtccaaggttcagcaacggcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggagatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

DBGET integrated database retrieval system