KEGG   Rattus norvegicus (rat): 116591
Entry
116591            CDS       T01003                                 

Gene name
Fcgr2a
Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor III
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04666  Fc gamma R-mediated phagocytosis
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116591 (Fcgr2a)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    116591 (Fcgr2a)
   04650 Natural killer cell mediated cytotoxicity
    116591 (Fcgr2a)
   04666 Fc gamma R-mediated phagocytosis
    116591 (Fcgr2a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    116591 (Fcgr2a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    116591 (Fcgr2a)
   05152 Tuberculosis
    116591 (Fcgr2a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    116591 (Fcgr2a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    116591 (Fcgr2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116591 (Fcgr2a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    116591 (Fcgr2a)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    116591 (Fcgr2a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    116591 (Fcgr2a)
CD molecules [BR:rno04090]
 Proteins
  116591 (Fcgr2a)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  116591 (Fcgr2a)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 Ig_5
Other DBs
NCBI-GeneID: 116591
NCBI-ProteinID: NP_446295
RGD: 71069
Ensembl: ENSRNOG00000046663
UniProt: P27645 M0R4F7
Position
13
AA seq 267 aa
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVI
SDWLLLQTPQLVFLEGERITLRCHGWKSIQLARISFLQNGEFVSFHPYNVSYSISNANHS
HSGDYYCKAYLGRTEHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRRSLSVGKYKAPQDK
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccgtacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttctggaaggagaaagaatcaca
ttgaggtgtcacggctggaagagcatacagctggccaggatttcattcctccagaatgga
gaatttgtgtcatttcatccttataatgttagctactccatctcaaacgccaaccacagt
cacagtggggactactactgcaaagcatatctaggaaggacagaacacgtgtccaagcct
gtcaccatcactgtccaaggttcagcaacggcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggagatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

KEGG   Rattus norvegicus (rat): 289211
Entry
289211            CDS       T01003                                 

Gene name
Fcgr2b
Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor II-b precursor
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04662  B cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    289211 (Fcgr2b)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    289211 (Fcgr2b)
   04666 Fc gamma R-mediated phagocytosis
    289211 (Fcgr2b)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    289211 (Fcgr2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    289211 (Fcgr2b)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    289211 (Fcgr2b)
   05152 Tuberculosis
    289211 (Fcgr2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    289211 (Fcgr2b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    289211 (Fcgr2b)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    289211 (Fcgr2b)
CD molecules [BR:rno04090]
 Proteins
  289211 (Fcgr2b)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set Ig_5 Protocadherin DUF2613 C2-set
Other DBs
NCBI-GeneID: 289211
NCBI-ProteinID: NP_786932
RGD: 631331
Ensembl: ENSRNOG00000046452
UniProt: Q63203 Q5BKD6
Position
13
AA seq 285 aa
MDSNRTVVHVLSRTLYHMLLWTAVLNLVAESHAGLPKAVVKLEPPWIQVLKEDTVTLMCE
GTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDW
LLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSG
NYYCKAYLGRTMHVSKPVTITVQEPKSSSSLPVLTIVAAVAGIAVAAIVIILVSLVYLKK
KQVPDTPSGLEEAEKNEVENTITYSLLKHPEAPDEESDHDYQNHI
NT seq 858 nt   +upstreamnt  +downstreamnt
atggacagcaacaggactgtcgtccatgtgctctcacggactttgtaccatatgctactg
tggacagctgtgctaaatcttgttgctgagtctcatgcaggtcttccgaaggctgtggtg
aaacttgagcccccatggatccaggtgcttaaggaagacactgtgacactgatgtgcgaa
gggacccacaacaccaagaactgttctactcagtggtttcacaatgggagctccatctgg
catcaagcccaagccaactacacgtttaaggccacagtcaatgatagtggagaataccgg
tgccgaatggaggagaccggcatcagcgaacccatacatctgggagtgatttctgactgg
ctgctactccagacctctcaactggtgtttgaagaaggggaaaccatcacattaaggtgc
catagctggaagaacaaacagctgactaaggtcttgttgttccagaatggaaaacctgtg
aggtattatcatcaaagcagcaatttttcaatccccaaagccaaccacagtcacagtggg
aactactattgcaaagcatatctaggaaggacaatgcacgtgtccaagcctgtcaccatc
actgtccaagagcccaaatccagcagttcgttgccggtattgacgattgtagctgctgtc
gctggaattgctgtagctgccattgttattatcctggtatccttggtctatctcaagaaa
aagcaggttccagacactccttctggtctcgaagaagctgagaaaaatgaggtggagaat
acaatcacctattcacttctcaagcatcctgaagctccggatgaagaatcagatcacgac
taccagaaccacatttag

KEGG   Rattus norvegicus (rat): 295279
Entry
295279            CDS       T01003                                 

Gene name
Fcgr1a
Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I precursor
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno04666  Fc gamma R-mediated phagocytosis
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    295279 (Fcgr1a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    295279 (Fcgr1a)
   04613 Neutrophil extracellular trap formation
    295279 (Fcgr1a)
   04666 Fc gamma R-mediated phagocytosis
    295279 (Fcgr1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    295279 (Fcgr1a)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    295279 (Fcgr1a)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    295279 (Fcgr1a)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    295279 (Fcgr1a)
   05152 Tuberculosis
    295279 (Fcgr1a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    295279 (Fcgr1a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    295279 (Fcgr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    295279 (Fcgr1a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    295279 (Fcgr1a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    295279 (Fcgr1a)
CD molecules [BR:rno04090]
 Proteins
  295279 (Fcgr1a)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 I-set
Other DBs
NCBI-GeneID: 295279
NCBI-ProteinID: NP_001094306
RGD: 1309912
Ensembl: ENSRNOG00000021199
UniProt: A0A0B4J2J0
Position
2
AA seq 353 aa
MWLLTTLLLWVPVGGQVVNATKAVVTLQPPWLSIFQEENVTLLCEGPHLGDSSTKWFINS
TAIQISTPTYSILKASFKDSGEYKCQTGLSMPSDPVQLEIYRDWLLLQTSHRVLTEGEPL
ALRCHPWQNKKVYNVAFYRNGESLDFSQGSEVTILKTNLSHSGIYHCSAMGKKLFKSAGV
SVTVKELFATPVLRVSLSSPFPEGSLVILNCETRLFLQSPGLRLYFSFYVGSKILEDRST
SSEYHIPRAEREDDGSYWCEVATEDGRVLKRSTKLELFGPQSSDPVWFHILFYLSVGIMF
LVNTVLYVKIHRLQREKKYNLEVPLVSEKGKKATSFQQVRSDDVYEEVTATVR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtggcttctaacgactctgctactttgggttccagttggtgggcaagtagttaatgcc
acaaaggctgtggtcaccttgcagcccccatggctcagcattttccaggaggaaaatgtc
actttgttgtgtgagggacctcacctgggagacagttccacaaagtggtttatcaacagc
acagccattcagatctccacacctacctatagcatcctcaaggccagtttcaaggacagt
ggtgaatacaagtgtcagacaggtctctcaatgccaagtgaccctgtgcagttagaaatc
tacagagattggctgctactccagacctcccacagagtcctcacagaaggagagcctctg
gccttgaggtgtcacccgtggcagaataagaaagtgtacaatgtggctttctatcgaaat
ggagaatcccttgacttttctcaaggttcagaggtcaccattctgaaaaccaacctgagt
cacagcggcatctatcactgctcagccatgggaaaaaaactcttcaagtctgcaggagtg
tctgtcaccgtgaaagagctatttgccacaccagtgctgagagtgtccttgtcatctccc
ttcccggaggggagtctggtcatcctgaactgtgagacaagattgttcctgcagagtcct
ggcttacggctttacttctccttctatgtgggcagtaagatcctggaggacaggagcaca
tcctccgagtaccacataccaagggctgaaagggaagatgatggatcatactggtgcgag
gtagccacggaggacggccgtgtccttaagcgcagcaccaagttggagctatttggtccc
cagtcatcagatcctgtctggtttcacatcctattttatctgtcagtgggaataatgttt
ttggtgaacacagttctctatgtgaaaatacacaggctgcagagagagaaaaaatacaat
ttagaagtccctttggtttctgagaaggggaagaaagcaacttcctttcagcaagttaga
agcgatgacgtgtatgaagaagtaacagccactgtaagatag

KEGG   Rattus norvegicus (rat): 304966
Entry
304966            CDS       T01003                                 

Gene name
Fcgr3a
Definition
(RefSeq) Fc fragment of IgG receptor IIIa precursor
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04666  Fc gamma R-mediated phagocytosis
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    304966 (Fcgr3a)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    304966 (Fcgr3a)
   04650 Natural killer cell mediated cytotoxicity
    304966 (Fcgr3a)
   04666 Fc gamma R-mediated phagocytosis
    304966 (Fcgr3a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    304966 (Fcgr3a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    304966 (Fcgr3a)
   05152 Tuberculosis
    304966 (Fcgr3a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    304966 (Fcgr3a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    304966 (Fcgr3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    304966 (Fcgr3a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    304966 (Fcgr3a)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    304966 (Fcgr3a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    304966 (Fcgr3a)
CD molecules [BR:rno04090]
 Proteins
  304966 (Fcgr3a)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  304966 (Fcgr3a)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 V-set I-set Ig_5 Ig_6
Other DBs
NCBI-GeneID: 304966
NCBI-ProteinID: NP_997486
RGD: 1303067
Ensembl: ENSRNOG00000024382
UniProt: Q6XPU4
Position
13
AA seq 249 aa
MWYLLLPTALLLTVSSGVGAGLQKAVVILDPEWVRVLEEDCVILRCQGTFSPEDNSTKWF
HNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEG
DPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNI
SSASLQISIGDPTSPSSFLPWHQITFCLLIGLLFAIDTVLYFSVQRSLQSSVAVYEEPKL
HWSKEPQDK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtggtacctactactaccaacggcactgctacttacggtttcctctggcgttggagct
ggtctccaaaaggctgtggtgatcctagaccctgaatgggtcagggttctcgaggaagac
tgtgtgatcctcaggtgccagggcaccttctcccccgaggacaattctaccaaatggttc
cataacaaaagcctcatctcgcaccaggacgccaactatgtcatccaaagtgccagagtt
aaggacagtggaatgtacagatgccagacagccttctccgcgctcagtgacccggtgcag
ctagacgtccatgcagactggctattgcttcagaccactaagcggctgttccaggagggg
gaccccattcgtctgagatgccatagctggcgaaacacgcctgtatttaaggttacctat
ttacagaatggcaaaggcaagaagtatttccataggaattctgaactcagtatttcaaaa
gctacgcacgccgacagtggttcctacttctgcagagggatcattggacgcaacaacata
tcttcagcatccttgcagataagcataggagatccgacgtctccctccagctttctaccg
tggcatcaaatcactttctgcctgctgataggactcttgtttgcaatagacacagtgctg
tatttctcggtgcagaggagtcttcaaagttccgtggcagtctatgaggaacccaaactt
cactggagcaaggaacctcaggacaagtga

KEGG   Rattus norvegicus (rat): 498276
Entry
498276            CDS       T01003                                 

Definition
(RefSeq) Fc gamma receptor II beta
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04666  Fc gamma R-mediated phagocytosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    498276
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    498276
   04613 Neutrophil extracellular trap formation
    498276
   04666 Fc gamma R-mediated phagocytosis
    498276
  09158 Development and regeneration
   04380 Osteoclast differentiation
    498276
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    498276
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    498276
   05150 Staphylococcus aureus infection
    498276
   05152 Tuberculosis
    498276
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    498276
  09163 Immune disease
   05322 Systemic lupus erythematosus
    498276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    498276
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    498276
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    498276
CD molecules [BR:rno04090]
 Proteins
  498276
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 Ig_5
Other DBs
NCBI-GeneID: 498276
NCBI-ProteinID: NP_001129464
RGD: 1594388
UniProt: P27645 B0K007
Position
13
AA seq 267 aa
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVI
SDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHS
HSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRKSLSVGKYKAPQDK
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccatacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttgaggaaggggaaaccatcaca
ttaaggtgccatagctggaagaacaaacagctgactaaggtcttgttgttccagaatgga
aaacctgtgaggtattattatcaaagcagcaatttttcaatccccaaagccaaccacagt
cacagtgggaactactactgcaaagcatatctaggaaggacaatgcatgtgtccaagcct
gtcaccatcactgtccaaggttcagcaaccgcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggaaatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

DBGET integrated database retrieval system