KEGG   Rattus norvegicus (rat): 116592Help
Entry
116592            CDS       T01003                                 

Gene name
Tff2
Definition
(RefSeq) trefoil factor 2
  KO
K22453  trefoil factor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    116592 (Tff2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trefoil TEX29
Motif
Other DBs
NCBI-GeneID: 116592
NCBI-ProteinID: NP_446296
RGD: 620709
Ensembl: ENSRNOG00000001162
UniProt: Q09030
Position
20p12
AA seq 129 aa AA seqDB search
MGPRGAPLLVVVLVLGLHALAEGEKPSPCRCSRMTPSNRKNCGFPGITSDQCFNLGCCFD
SSVAGVPWCFHPLPNQASEQCVMEVSARENCGYPGISPEDCASRHCCFSNLIFEVPWCFF
PQSVDDCHY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggccctcgaggtgcccctctcttggtagtggtccttgtcttggggctgcatgccctg
gcggaaggcgagaaaccttctccctgtcggtgctccaggatgacgccctccaacagaaag
aactgtggcttcccgggcatcaccagtgaccagtgctttaatcttggatgctgctttgac
tctagtgttgctggggtcccctggtgtttccacccacttccaaaccaagcgtcggaacaa
tgtgtcatggaagtgtcagcccgcgagaattgtggatacccgggcatcagccctgaggac
tgtgccagccgacactgctgcttttccaacctgatcttcgaagtgccctggtgtttcttc
ccacagtctgtggatgattgtcactactga

DBGET integrated database retrieval system