KEGG   Rattus norvegicus (rat): 116593
Entry
116593            CDS       T01003                                 

Gene name
Upb1, Bup1
Definition
(RefSeq) beta-ureidopropionase 1
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00410  beta-Alanine metabolism
rno00770  Pantothenate and CoA biosynthesis
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    116593 (Upb1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    116593 (Upb1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    116593 (Upb1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    116593 (Upb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     116593 (Upb1)
SSDB
Motif
Pfam: CN_hydrolase Tugs
Other DBs
NCBI-GeneID: 116593
NCBI-ProteinID: NP_446297
RGD: 620091
UniProt: Q03248
Position
20p12
AA seq 393 aa
MAGPEWQSLEQCLEKHLPPDDLSQVKRILYGKQTRNLDLPRKALEAASERNFELKGYAFG
AAKEQQRCPQIVRVGLVQNRIPLPTSAPVAEQVSALHKRIEEIAEVAAMCGVNIICFQEA
WNMPFAFCTREKLPWTEFAESAEDGLTTRFCQKLAKKHNMVVISPILERDRDHGGVLWNT
AVVISNSGLVMGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPL
NWLMYSVNGAEIIFNPSATIGELSESMWPIEARNAAIANHCFTCALNRVGQEHYPNEFTS
GDGKKAHHDLGYFYGSSYVAAPDGSRTPGLSRNQDGLLVTELNLNLCQQINDFWTFKMTG
RLEMYARELAEAVKPNYSPNIVKEDLVLAPSSG
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcgggacctgagtggcagtccctggagcagtgcctggaaaagcatctgccgcctgac
gatttgagccaggtgaagcgaattctctacggcaagcaaactaggaatcttgatctgccc
agaaaagctttagaagctgcctcagaaagaaacttcgaactgaagggatacgccttcggg
gcagccaaggaacagcagagatgtccccagatcgtgcgcgtggggctcgttcagaacaga
atcccgctccccacttccgcccctgtggcagaacaggtctctgccctccacaaacgcata
gaggaaatagctgaggtggcagcaatgtgcggagtcaacatcatctgtttccaggaagcc
tggaatatgcccttcgctttttgtacacgagagaaacttccttggacagaatttgctgag
tcagcagaggacgggctcaccaccaggttctgtcagaagctggcaaagaagcacaacatg
gtggtgatatctccaatcttggagcgtgacagagatcacgggggagttctatggaacaca
gctgtggtgatctccaactcgggactggtcatgggaaagaccagaaagaatcacatcccc
agagtgggcgacttcaatgagtccacttactacatggagggaaacctcggccaccccgtg
ttccagacccagtttggcaggattgccgtgaacatctgctatgggcggcaccaccccctc
aactggctcatgtacagcgtcaacggagctgaaatcatcttcaacccttcagccaccatt
ggagaactcagtgagtccatgtggccgatcgaagccagaaacgcagccatcgctaatcac
tgcttcacctgtgccctcaaccgtgtgggtcaggaacactaccccaatgagtttacttct
ggagatggaaagaaagctcaccatgacctcggctacttctacggttcgagctacgtggca
gctcctgacggtagccggacccccggcctctcacgcaatcaggacgggctgctggtcact
gagctcaacctcaacctatgccagcagattaatgatttctggactttcaagatgacgggc
cgacttgagatgtatgcccgggagcttgccgaagctgtcaaacccaactacagtcccaac
attgtgaaggaagacctggttctagcccctagctcgggttag

DBGET integrated database retrieval system