KEGG   Rattus norvegicus (rat): 116595Help
Entry
116595            CDS       T01003                                 

Gene name
Nrxn2
Definition
(RefSeq) neurexin 2
  KO
K07377  neurexin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    116595 (Nrxn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116595 (Nrxn2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    116595 (Nrxn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 Syndecan EGF hEGF DUF202
Motif
Other DBs
NCBI-GeneID: 116595
NCBI-ProteinID: NP_446298
RGD: 620211
Ensembl: ENSRNOG00000021103
Vega: OTTRNOG00000002163
UniProt: Q63374
Structure
PDB: 

Position
1q43
AA seq 1715 aa AA seqDB search
MALGSRWRPPPQLPPLLLLLALVAGVRGLEFGGGPGQWARYARWAGAASTGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGNVHQPTKGKEEFVATFKGNESFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSANYVNLSLKSGAVWLIINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTM
LGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQG
DLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGA
GVGSHSSSQRADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKG
SISVNSRSTPFLATGESEVLDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRD
LFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADT
LRLELDGGQMKLTVNLDCLRVGCAPSAAAKGPETLFAGHKLNDNEWHTLRVVRRGKSLQL
SVDNVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCK
DGDITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLF
NSGNGNDFIVIELVKGYIHYVFDLGNSPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLK
IDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPD
LIADALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGT
TYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQ
GTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDN
ERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNG
LKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTT
RRGRSPTMRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVA
TRSPFVPPPPTFYPFLTGVGATQDTLPPPAARRPSSGGPCQAERDDSDCEEPVEASGFAS
GEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLLAPSAPA
PNLPAGKMNHRDPLQPLLENPPLGPGVPTAFEPRRPPPLRPGVTSVPGFPRLPTANPTGP
GERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYI
SNSAQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgggagtcggtggcgaccgccaccccagttgccgccgctgctgttgttgctg
gcgctggtggcaggcgtccgtggcttggagtttggcggcggccccgggcagtgggctcgc
tacgcgcgctgggcaggcgcggcgagcaccggcgagctcagcttcagcctgcgcaccaac
gccacgcgcgcgctgctgctctacctggacgacggcggcgactgcgacttcctggagctg
ctgctggtggacgggcgcctgcggctgcgcttcacgctgtcttgcgccgagcccgccacg
ctgcagttggacacgccggtggccgacgaccgctggcacatggtgctgctgacccgcgac
gcgcggcgcacggcgctggcggtggacggcgaagcccgtgcggccgaggtgcgctcaaag
cggcgcgagatgcaggtggccagcgacctgttcgtgggcggcatcccacccgacgtgcgc
ctgtctgcgctcacgctcagcaccgtcaagtacgagccgcctttccgcggcctcctggcc
aacctgaagctgggcgagcggccgccggcgctgctgggtagccagggtctgcgcggtgcg
gccgccgaccccctgtgcgcgcccgcacgcaatccctgcgccaacggcggcctctgcacc
gtgctagcccccggcgaggtgggctgcgactgcagccacactggcttcggcggcaagttc
tgcagtgaagaggaacaccccatggaaggtccggctcacctgacgttaaacagcgaagta
gggtccttactgttctccgaggggggggccgggagaggaggagccggcaatgtgcaccag
ccaacaaaaggcaaggaggaatttgtggcaaccttcaagggcaatgagtccttctgctac
gacctgtcacacaacccgatccagagcagcactgatgagatcacactggccttccgcacc
ctgcagcgcaacgggctgatgctgcacacggggaagtcggctaactacgtcaacctgtcc
ctcaagtccggggctgtctggctgatcatcaacctaggctcaggtgccttcgaggccctc
gtggaacccgtcaatggcaagttcaacgacaacgcctggcacgacgtccgggttacccga
aacctgcgccagcacgcagggattggacacgctatggtaaacaaactgcattatctggtg
accatctcggtggacgggatcctgaccaccacaggctacacgcaggaggattacaccatg
ctgggctctgatgacttcttctacattgggggcagccccaacacagccgacctgcctggc
tcccctgtcagcaacaacttcatgggctgtctcaaggacgtggtctacaagaataatgac
ttcaagctggagctatcccgactggctaaggaaggggacccgaagatgaagctgcagggg
gatttgtctttccgttgtgaggacgtggctgccttggaccctgtgaccttcgagagtcct
gaggcctttgtcgcactgccccgctggagcgccaagcgcactggttctatctccctggac
ttcagaaccacggagcccaatgggttgctgctcttcagccagggccggcgggctggggcc
ggggtaggcagccacagttccagccagagggccgactactttgccatggagctattggat
ggctacctctatcttctgctggacatgggctctgggggcatcaagctgcgggcgtccagc
cgcaaggtcaacgacggcgaatggtgccacgtggacttccagagggatgggcgcaaaggc
tccatctctgtgaacagccgcagtacaccattcttggccacaggagagagtgaggtcctg
gacctggagagtgagctgtacctgggcggtctccctgaggggggccgagtggacctgcca
ttgcctcctgaggtgtggacagctgctctccgggctggctacgtgggctgcgtgcgagac
ctcttcatagatggacggagtcgagatctccggggcctggctgaggcacagggagctgtg
ggcgttgcacctttctgctctcgggagaccctgaagcagtgtgcatcggccccctgtcgt
aatggtggcatctgtcgagagggctggaaccggttcgtctgtgattgcatcgggaccggc
tttctgggtcgggtctgcgagagagaggccacagtcttaagctatgatggctccatgtac
atgaagatcatgctgcccaatgccatgcacacggaagcagaggatgtgtccctgcgattc
atgtcccagagggcttatggactcatgatggccaccacctctagggagtcggccgacact
ctgcgtctcgagctggacggggggcagatgaagctcacagtcaacctcgactgcctgcgc
gtcggctgcgcacccagtgctgcagctaaaggccccgagaccctctttgcggggcacaag
ctcaacgacaatgagtggcacacgctgagggtggtacggcgtggcaagagcctgcagctg
tctgtggacaacgtgactgtggagggacagatggcaggagcccacacgcggctggagttc
cacaacatcgagacaggcatcatgacagagcgacggtttatctctgtggtgccctccaac
ttcatcggccacctgagcgggctggtgttcaatggtcaaccctacatggaccagtgcaaa
gatggagacatcacctactgtgagcttaatgcccgctttgggctgcgtgccatcgtggct
gatcctgttaccttcaagagtcgcagtagctacctggcgttggccacgctccaagcctat
gcctccatgcacctcttcttccagttcaagaccacagcccctgatggacttctgctgttc
aactcaggcaacggcaatgacttcattgtcatcgagctggtcaaggggtacatccactac
gtgtttgacctgggaaatagcccgtccttgatgaagggaaactcagacaaaccagttaat
gacaaccagtggcacaacgtggtggtgtccagggacccaggcaacgtgcacacgctgaag
attgactcccgcacggtcacgcagcattccaacggtgcccgaaatctggatctcaaaggg
gagttgtacatcggtggcctgagcaagaacatgttcagcaacctgccaaagctggtggcc
tctcgggatggctttcagggctgcctggcttctgtggacctcaacgggcgcctcccagac
ctcatcgcagacgccctgcaccgaatcgggcaggtggagaggggctgtgatggccccagt
accacctgcaccgaagagtcctgtgccaaccagggcgtctgcctgcagcagtgggacggc
tttacctgtgactgcaccatgacttcctatggaggccctgtctgcaatgaccctgggacc
acatacatctttgggaaggggggagcgctcatcacctatacatggcctcccaatgaccga
cccagcacaaggatggaccgcctggccgtaggcttcagcacccaccagcggagcgctgtg
ctggtacgcgtggacagtgcctccggcctcggggactacctgcagctgcacattgaccag
ggcactgttggggtgatttttaatgtgggcacggatgacattacaattgatgagcccaac
gccatcgtgagcgacggcaaatatcacgtggtgcgcttcactcgaagtggtggcaatgcc
actttgcaggtggacagctggccagtcaacgagcggtacccggcagggaactttgataac
gagcgcctggcgattgctagacagagaatcccctaccggcttggtcgagtagtagatgaa
tggctgctcgacaaaggacgccagctgaccatcttcaacagccaggctgccatcaagata
gggggccgggatcagggccgccccttccagggccaggtgtccggcctctactacaatggg
ctcaaggtactggcgctggccgccgagagcgaccccaatgtgcggaccgaaggccacctg
cgcctagtaggggaagggccgtccgtgctgctcagtgcagagaccactgccaccactctg
ctggccgacatggccaccaccatcatggagaccaccaccaccatggccaccaccactact
cgccggggccgctcccccacaatgagggacagcaccacccagaacacagatgaccttctg
gtggcctcggctgagtgtccaagtgatgatgaggacctggaggagtgtgagcctagtact
ggaggagagttaatattgcccattatcacggaggactccttagacccccctcccgtggcc
acccggtcccccttcgtgcccccgccccccaccttctacccctttctcacgggcgtgggt
gccacccaagacaccctgcctccgcccgccgcgcgccgcccgtcctccgggggcccgtgt
caggccgagcgcgacgacagcgactgcgaggagcccgtggaagcctcgggcttcgcctcc
ggggaggtctttgactccagcctcccccccacggacgacgaggacttttacaccaccttc
cccttggtcacggaccgcaccaccctcctgtcaccccgcaagcctgcgccccgacctaac
ctcaggacagatggggccacgggcgcccccggggtgctacttgcgccctccgccccagcc
cccaacctgcccgcgggcaaaatgaaccaccgagacccactgcagccgctgctggagaac
ccacccctggggcctggggtccccacggccttcgagccgcggcggccgcctcccctgcgc
cccggcgtgacctcagtccccggtttcccccgtctgcccacagccaaccccacgggtccg
ggggagcgcggcccgccgggcgcggtggaagtgatccgcgaatccagcagcaccacgggc
atggtggtgggcatcgtggcggcggcggcgctctgcatccttatccttctctacgccatg
tacaagtaccgcaaccgcgacgagggctcctaccaagtggaccagagccggaattacatc
agtaactcggcccagagcaatggggcggtggtgaaggagaaggcccccgctgcccccaag
acgcccagcaaggccaagaagaacaaagacaaagagtattacgtctga

DBGET integrated database retrieval system