KEGG   Rattus norvegicus (rat): 116596
Entry
116596            CDS       T01003                                 

Gene name
Map3k8
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 8
  KO
K04415  mitogen-activated protein kinase kinase kinase 8 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116596 (Map3k8)
   04668 TNF signaling pathway
    116596 (Map3k8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    116596 (Map3k8)
   04660 T cell receptor signaling pathway
    116596 (Map3k8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116596 (Map3k8)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     116596 (Map3k8)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  Other
   116596 (Map3k8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal HTH_8 APH RIO1
Other DBs
NCBI-GeneID: 116596
NCBI-ProteinID: NP_446299
RGD: 620969
Ensembl: ENSRNOG00000016378
UniProt: Q63562
Position
17
AA seq 467 aa
MEYMSTGSDEKEEIDLLINHLNVSEVLDIMENLYASEEPAVYEPSLMTMCPDSNQNKEHS
ESLLRSGQEVPWLSSVRYGTVEDLLAFANHISNTTKHFYGCRPQESGILLNMVISPQNGR
YQIDSDVLLVPWKLTYRSIGSGFVPRGAFGKVYLAQDMKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYLPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIAGDCSPG
MRELIEAALERNPNHRPKAADLLKHEALNPPREDQPRCQSLDSALFDRKRLLSRKELELP
ENIADSSCTGSTEESEVLRRQRSLYIDLGALAGYFNIVRGPPTLEYG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggagtacatgagcaccggaagcgacgagaaagaagagattgatttattaattaaccat
ttaaacgtgtcggaagtcctggacatcatggagaacctttatgcaagtgaagagcctgca
gtgtatgagcccagtctgatgaccatgtgtccagacagcaatcaaaacaaggaacattca
gagtcgctgcttcggagtggccaggaggtgccctggttgtcgtctgtcagatatgggact
gtggaggatctgcttgcatttgcaaaccatatctcgaatacgacaaagcatttttacgga
tgtcggccccaagaatctgggattttattaaatatggtaatcagtccccagaatggtcgc
taccaaatcgactcggatgttctccttgtcccgtggaagctgacgtacaggagcattggt
tctggtttcgttcctcggggggcctttggaaaagtgtacttagcacaagacatgaagaca
aagaaaagaatggcatgtaaactgatccctgtagatcagtttaagccatcagatgtggaa
atccaggcctgcttccggcacgagaacattgctgagttatacggtgcggtcctatggggc
gacactgtccatctcttcatggaagctggcgagggagggtctgtcctggagaagctggag
agctgtgggcccatgagagaatttgaaattatctgggtgacaaagcacgttctcaaggga
cttgattttctgcactccaagaaagtcatccaccacgatatcaaacctagcaacattgta
ttcatgtctacgaaagctgtgttggtagattttggcctgagtgttcaaatgacagaagat
gtctatctccccaaggacctccggggaacagagatctacatgagccctgaggtgattctg
tgcaggggccattccacaaaagcagacatctacagccttggagccacgctcattcacatg
cagacaggcaccccaccctgggtgaagcgctaccctcgatcggcctatccctcctacctg
tacataatccacaagcaggcacctcccctggaagatattgctggtgactgcagtccaggc
atgagggagctgatagaagccgccctggagaggaaccccaaccaccgcccaaaagcagca
gacctactgaaacacgaagccctgaatcccccaagagaggaccagccacggtgtcagagt
ctggactctgccctctttgaccggaagaggctgctgagcaggaaggagctagaacttcct
gagaacattgctgattcatcatgcacaggaagcaccgaggagtctgaagtgctcaggaga
cagcgttccctctacattgatctcggagctctggctggctacttcaatattgttcgtggt
ccaccaaccctggaatatggctga

DBGET integrated database retrieval system