KEGG   Rattus norvegicus (rat): 116601
Entry
116601            CDS       T01003                                 

Gene name
Atp2a1
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04919  Thyroid hormone signaling pathway
rno04972  Pancreatic secretion
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    116601 (Atp2a1)
   04024 cAMP signaling pathway
    116601 (Atp2a1)
   04022 cGMP-PKG signaling pathway
    116601 (Atp2a1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    116601 (Atp2a1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    116601 (Atp2a1)
   04261 Adrenergic signaling in cardiomyocytes
    116601 (Atp2a1)
  09154 Digestive system
   04972 Pancreatic secretion
    116601 (Atp2a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116601 (Atp2a1)
   05017 Spinocerebellar ataxia
    116601 (Atp2a1)
   05022 Pathways of neurodegeneration - multiple diseases
    116601 (Atp2a1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    116601 (Atp2a1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    116601 (Atp2a1)
   05414 Dilated cardiomyopathy
    116601 (Atp2a1)
   05415 Diabetic cardiomyopathy
    116601 (Atp2a1)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     116601 (Atp2a1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD SAND
Other DBs
NCBI-GeneID: 116601
NCBI-ProteinID: NP_478120
RGD: 621293
UniProt: Q64578 B4F7E5
Position
1
AA seq 994 aa
MEAAHSKSTEECLSYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDL
LVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGDICSLNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALC
NDSSLDFNETKGVYEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGP
VKEKIMSVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSAKFMEYEMDLTFVGVVGML
DPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFSENEEVADRAYTGREFDD
LPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAI
GGYVGAATVGAAAWWFLYAEDGPHVSYHQLTHFMQCTEHNPEFDGLDCEVFEAPEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLR
ALDFTQWLMVLKISLPVIGLDELLKFIARNYLEG
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggaggccgcacactccaagtccacagaggaatgtttgtcctattttggggtgagcgag
accacaggccttaccccagaccaagttaagcggcatctggaaaaatacggccccaatgag
ctccctgctgaggaaggcaagtctctgtgggagttggtggtagagcagttcgaagacctg
ctggtgcggattctcctcctggctgcctgcatttcctttgtgctggcctggtttgaggaa
ggtgaggaaactgtcactgcctttgtggagccttttgtcattctcttgatcctcattgcc
aacgccattgtgggggtttggcaggaacggaatgcagagaatgccatcgaggcgctgaag
gaatatgaacccgagatggggaaggtctatcgggctgaccgaaagtcagtgcaaaggatc
aaggctcgggacatcgtccctggggacattgtggaggtggctgttggggacaaagtccct
gcagacatccgaatcctctccatcaaatccaccaccctccgggtcgaccagtccatcctg
acaggagagtctgtatctgtcatcaagcacacagaccctgtccctgatccccgagctgtc
aaccaggacaagaagaacatgctcttctcgggtaccaacattgcagccggcaaggccgta
ggcatcgtggccaccactggtgtgagtactgagattggcaagatccgagaccaaatggct
gccactgagcaggacaagaccccgcttcagcagaagcttgatgagtttggggaacagctg
tccaaggtcatctctctcatctgtgtggctgtctggcttatcaacattggtcacttcaac
gaccctgtccatgggggctcctggttccggggggccatttactacttcaagattgctgta
gccttggctgtggcagccatcccagaagggcttcctgctgtcatcaccacctgcttggcc
ttgggtacccgccggatggcaaagaagaacgccatcgtgaggagtttgccctctgtggag
accctgggctgtacctctgtcatctgttctgacaaaacagggaccctcaccaccaaccag
atgtcagtttgcaagatgttcatcattgacaaagtggatggggatatctgctcactgaac
gagttctccatcactggctctacttatgctcctgagggagaagttttgaagaatgataag
ccagtccgagcagggcagtatgacgggctggtggaacttgctaccatctgtgccctctgc
aatgactcctccttggactttaatgagaccaaaggtgtctatgagaaggtgggcgaggcc
accgagacagccctcaccaccttggtggagaagatgaatgtgttcaacacggaagtgaga
agcctctccaaagtggagcgggctaatgcctgcaactcggtgatccgccaactaatgaag
aaggaattcaccctggaattttcccgagacaggaagtctatgtctgtctactgctcccca
gccaagtcttcacgggctgctgtaggcaacaagatgtttgtcaagggtgcccctgagggc
gtcattgaccgctgtaactatgtgcgtgttggcacaacccgtgtgccactgacaggccct
gtgaaggagaagatcatgtcggtgatcaaggagtggggtactggtcgggataccctacgg
tgcctggcactggccacccgggacacaccccccaaacgggaggaaatggttctggatgac
tcagccaagttcatggagtatgagatggacctgacgtttgttggtgtggtgggcatgttg
gatccaccccgtaaggaggtcacaggctctatccagctgtgtcgtgatgccgggatccga
gtgatcatgatcactggggacaacaagggtaccgccatcgccatctgccgacgaattggc
atcttttcggagaatgaggaagtggcagaccgtgcctacactggccgtgagtttgatgat
ctgcccctggctgagcagcgggaagcctgcagacgcgcctgctgcttcgctcgtgtggag
ccctcacataagtccaagattgtggagtacctgcagtcctatgatgagatcacagccatg
acaggggatggtgtcaatgatgcccctgctctgaagaaggcggagattggcattgccatg
ggatctggtactgctgtggctaagactgcctccgagatggtactggctgatgataacttc
tccaccattgtggctgccgtggaggaaggccgtgccatctacaacaacatgaagcagttc
atccgctacctcatttcctccaatgtgggcgaggtggtctgtatcttcttgacagcagcc
ttggggctgcctgaggccttgatccctgtgcagctgctatgggtgaacttggtgactgat
gggctccctgctactgccctggggttcaacccacctgacctggacatcatggaccgtccc
cccaggagtcccaaggagcctcttatcagtggctggctctttttccgctacatggcaatt
gggggctacgtgggtgcagccactgtgggagcagctgcctggtggttcttgtatgcagag
gatgggcctcatgtcagctaccatcaactgactcatttcatgcagtgcactgagcataac
cctgaatttgatggcctggactgcgaggtctttgaagcccccgagcccatgaccatggcc
ttgtctgtgttggtgaccatcgagatgtgcaacgccctcaacagcctgtctgagaaccag
tccctactgcggatgccgccctgggtgaacatctggcttctcggttccatctgcctgtcc
atgtccctccacttcctcatcctctatgttgaccccctgccgatgatcttcaagctccgg
gccctggactttacccagtggctcatggtcctcaagatctcacttccagtcatcgggcta
gatgagcttctcaagttcattgctcggaactatctggagggataa

KEGG   Rattus norvegicus (rat): 25391
Entry
25391             CDS       T01003                                 

Gene name
Atp2a3
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04919  Thyroid hormone signaling pathway
rno04972  Pancreatic secretion
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25391 (Atp2a3)
   04024 cAMP signaling pathway
    25391 (Atp2a3)
   04022 cGMP-PKG signaling pathway
    25391 (Atp2a3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    25391 (Atp2a3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25391 (Atp2a3)
   04261 Adrenergic signaling in cardiomyocytes
    25391 (Atp2a3)
  09154 Digestive system
   04972 Pancreatic secretion
    25391 (Atp2a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25391 (Atp2a3)
   05017 Spinocerebellar ataxia
    25391 (Atp2a3)
   05022 Pathways of neurodegeneration - multiple diseases
    25391 (Atp2a3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    25391 (Atp2a3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    25391 (Atp2a3)
   05414 Dilated cardiomyopathy
    25391 (Atp2a3)
   05415 Diabetic cardiomyopathy
    25391 (Atp2a3)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     25391 (Atp2a3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 25391
NCBI-ProteinID: NP_037046
RGD: 2175
Ensembl: ENSRNOG00000017912
UniProt: P18596
Position
10
AA seq 999 aa
MEEAHLLSAADVLRRFSVTAEGGLTLEQVTDARERYGPNELPTEEGKSLWELVVEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTDAIPDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEAEAGACRLHEFTISGTTYTPEGEVRQGEQLVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRVERAGACNSVIKQLMQ
KEFTLEFSRDRKSMSVYCTPTRADPKAQGSKMFVKGAPESVIERCSSVRVGSRTVPLSAT
SREHILAKIRDWGSGSHTLRCLALATRDTPPRKEDMQLDDCSQFVQYETGLTFVGCVGML
DPPRPEVAACITRCSRAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVLGKAYTGREFDD
LSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDAEGPQVTFHQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLGAVVMSMALHFLILLVPPLPLIFQVT
PLSGRQWGVVLQMSLPVILLDEALKYLSRHHVDEKKDLK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggaggaggcgcacctgctctcggctgccgacgtgctgcgtcgcttctcggtgacagcc
gagggcggcttgaccctggagcaggtgaccgacgcccgggagcgatacggccccaacgaa
ctccctactgaggaagggaaatccctgtgggagctggtggtggagcagtttgaggacctc
ttggtgcgcatcctgctgctggcagccctggtttcctttgtcctggcctggtttgaggag
ggtgaggagaccacgacggccttcgtggagcccctcgtcatcatgttaatccttgtggcc
aatgcgatcgtgggagtgtggcaggaacgcaatgctgagagtgccattgaggccttgaag
gagtatgagcctgagatgggtaaggtgatccgctctgaccgcaagggtgtgcagaggatc
cgagccagggacatcgtccctggggacattgtggaagtggcagtgggagacaaggtacct
gctgacctccgcctcatcgagatcaagtccaccacacttcgagtggaccagtccatcctg
acaggggaatccgtgtctgtgactaagcacacagatgccattccagacccccgagccgtg
aaccaggacaagaagaacatgctgttttctggcaccaatattgcatcaggcaaagccctg
ggtgtggctgtggccacaggcttgcacacagagctgggcaagattcggagccagatggcg
gctgtggagcctgagcggacgccactgcagcgcaagctggatgaatttgggaggcagctg
tcccatgccatctctgtgatctgtgtggctgtgtgggtcatcaacatcggacactttgct
gacccggcccatggtggatcctggctccgtggggcagtctactacttcaagattgctgtg
gccctggctgtggctgctatccccgagggcctcccagcagtcatcactacatgcctagca
ctgggcacaagacgtatggcacgtaagaacgccattgtgcggagcctgccctctgtggag
accctgggctgcacctcagtcatctgctctgacaagacagggacactcaccaccaatcaa
atgtctgtctgcaggatgttcgtggtagctgaagcagaggcaggcgcctgtcgtttacac
gaattcaccatttcgggtaccacgtataccccagagggcgaagtgaggcaaggggaacag
cttgtgcgctgtgggcagtttgatggacttgtggagctcgcaaccatctgtgcactctgc
aatgattctgcactggactacaatgaggccaagggtgtgtatgagaaggtaggagaggcc
acagagacagccctcacttgcctggtagagaagatgaacgtgtttgacacagacctgaaa
ggactgtcgcgggtcgagcgcgctggtgcctgcaattccgtcatcaagcaactcatgcag
aaggagttcaccctcgaattctcccgggaccggaagtccatgtctgtgtactgcacaccc
actcgtgctgaccccaaggcccagggcagcaagatgtttgtgaagggagctcctgagagt
gtaattgagcgctgcagctcagtccgcgtgggaagccgaacagtacccctaagcgccacc
tccagagagcatatcctggccaagatccgagactggggctcaggctctcatacattgcgc
tgcttagcactggccaccagggacacacccccaaggaaggaggacatgcaactggatgac
tgcagtcagtttgtacagtacgagacaggcctgaccttcgtgggctgcgtgggcatgtta
gacccaccgagaccagaggtggctgcctgtatcacacgctgttctcgggcgggcattcga
gtggtcatgatcacaggggacaacaaagggacagctgtggccatctgccgccgacttggc
atctttggggatacggaggatgtgttgggcaaggcttacacgggccgagaattcgatgac
ctcagcccagagcagcagcgccaggcttgccgtaccgcccgatgctttgcccgtgtggaa
cccgcacataagtctcgcatcgtggagaacctccagtcctttaatgagatcaccgccatg
actggcgatggggtgaatgatgcaccagccctgaagaaggcagagatcggcatcgccatg
ggctcaggcactgctgtggccaagtcggcagcggagatggttctgtctgatgacaacttt
gcctccattgtggctgcagtggaggagggcagggccatctacaacaacatgaagcaattc
atccgctacctcatctcctccaatgttggcgaggttgtctgcatcttcctcacagcaatt
ctgggcctgcccgaagccctgatccctgtgcagctgctctgggtgaacctggtaacagat
ggcttacctgccacagcccttggcttcaacccacccgatctggacatcatggaaaagctg
cctcggaacccccgggaggctctcatcagcggctggctttttttccgctatttggctatt
ggagtgtacgtaggcctggctacagtggctgccgccacctggtggttcctgtatgacgct
gagggaccacaagtcaccttccatcagctgaggaacttcctgaagtgctctgaagacaat
ccactgtttgccggcatcgactgcgaggtctttgagtcacgcttccccacgaccatggcc
ttatctgtgcttgtgaccattgaaatgtgcaacgcccttaacagcgtctcagagaaccag
tcactgctgcgtatgccaccctggctgaacccttggctgctgggggctgtggtcatgtcc
atggccctgcattttctcatccttttggtgccgcctctgcccctcattttccaggtgacc
ccactgagtggtcgacagtggggggtggtgcttcagatgtctctgcctgtcatcctgctt
gacgaggccctcaagtatctgtccaggcatcacgtggatgaaaaaaaggacctgaagtaa

KEGG   Rattus norvegicus (rat): 29693
Entry
29693             CDS       T01003                                 

Gene name
Atp2a2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform b
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04919  Thyroid hormone signaling pathway
rno04972  Pancreatic secretion
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29693 (Atp2a2)
   04024 cAMP signaling pathway
    29693 (Atp2a2)
   04022 cGMP-PKG signaling pathway
    29693 (Atp2a2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29693 (Atp2a2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29693 (Atp2a2)
   04261 Adrenergic signaling in cardiomyocytes
    29693 (Atp2a2)
  09154 Digestive system
   04972 Pancreatic secretion
    29693 (Atp2a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29693 (Atp2a2)
   05017 Spinocerebellar ataxia
    29693 (Atp2a2)
   05022 Pathways of neurodegeneration - multiple diseases
    29693 (Atp2a2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    29693 (Atp2a2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    29693 (Atp2a2)
   05414 Dilated cardiomyopathy
    29693 (Atp2a2)
   05415 Diabetic cardiomyopathy
    29693 (Atp2a2)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     29693 (Atp2a2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 29693
NCBI-ProteinID: NP_001104293
RGD: 2174
Ensembl: ENSRNOG00000001285
UniProt: P11507
Position
12
AA seq 1043 aa
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDKVEGDTCSLNEFTITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
SPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNLTQWLMVLKISLPVILMDETLKFVARNYLEPGKECAQPATKPSCSLSACTDGISWPFV
LLIMPLVVWVYSTDTNFSDMFWS
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggagaacgctcacacaaagaccgtggaggaggtgctgggccacttcggcgtcaacgag
agcacggggctgagcctggagcaggtcaagaagctcaaggagagatggggctccaacgaa
ttgccggctgaagaaggaaagaccttgctggaacttgtgatcgagcagtttgaagactta
ctagttagaattttattgctggcagcatgtatatctttcgttttggcttggttcgaagaa
ggtgaagaaacgattacagcctttgtagaaccttttgtaattctgcttatattggtagcc
aatgcaattgtgggtgtatggcaggagagaaacgctgaaaatgcaatagaagctcttaag
gagtatgaacctgaaatgggcaaggtgtatcgacaggacagaaagagtgtgcagcggatt
aaagcgaaagatatagttcctggggatatagtggaaattgctgttggtgacaaagttccg
gctgacattagattgacatccatcaagtctacaactctgagagttgaccagtcgattctt
acaggtgaatctgtctcggtcatcaagcatactgaccctgtccctgacccacgagctgtt
aatcaagacaaaaagaacatgctcttttctggcacaaacatcgctgctggcaaagctatg
ggagtggtggtggcgactggagtcaatactgagatcggcaagatccgggatgaaatggtt
gcaacagaacaggagagaacacccctacagcagaagctggacgagtttggggaacagctt
tccaaagttatctccctcatttgcattgcagtctggatcatcaacatcgggcatttcaat
gacccagttcatggtggctcttggatcagaggtgccatctactactttaagattgcagtg
gccctggctgttgctgccatccctgagggtctgcctgctgtcatcaccacctgcttggct
cttggaactcgaaggatggcaaagaaaaatgctattgttcgaagtctgccttctgtggaa
acccttggttgtacttctgttatctgctcagacaagaccggcacacttaccacaaaccag
atgtccgtctgcaggatgttcattctggacaaagtagaaggtgatacttgttcccttaat
gagtttaccataactggatcaacctatgcacccattggagaagtgcaaaaagatgacaag
ccagtgaaatgccatcagtatgacgggcttgtagagttagcaacgatctgtgctctgtgt
aatgactctgctttggattacaatgaggcgaagggtgtgtatgaaaaagttggagaagcc
acagagactgctctcacgtgcctggtagagaagatgaatgtattcgacacggagctgaag
ggactttctaaaatagaacgcgccaacgcctgcaactcggtcataaaacagctcatgaag
aaggaattcacgctagagttttcacgtgatagaaaatcaatgtccgtctactgtacacca
aacaaaccgagccggacgtccatgagcaagatgtttgtgaagggtgctccagaaggtgtc
atcgacaggtgcacccacatccgagttggaagtaccaaggtccccatgacgcctggtgtt
aaacagaagattatgtctgtcattcgggagtggggcagtggcagcgacacactgcggtgc
ctggctctggccactcatgacaacccgctgaggagagaggagatgcacctggaagattct
gcgaacttcatcaaatatgagaccaatctgactttcgttggctgtgtgggcatgctggac
cctcccaggattgaagtggcctcttctgtgaagctgtgccggcaagcgggcatccgagtc
atcatgatcactggggataacaaaggcactgctgtggccatctgtcgccgcattggcatc
tttgggcaggatgaggatgtgacatcaaaggcttttacagggcgagaatttgatgaatta
agcccctcagcccagagagacgcctgcttaaatgcccgttgttttgctcgagttgaacct
tcccacaagtctaagatcgttgagttcctgcagtcctttgatgagatcacagctatgact
ggtgatggtgtgaacgacgcgcccgctctgaagaagtcggaaatcgggattgccatgggc
tcagggactgcagtggctaagacggcctctgagatggtgctggccgacgacaacttctcc
accatcgtggccgctgttgaggaggggcgcgccatctacaacaacatgaagcagttcatc
cgctacctcatctcctccaacgtgggggaggtggtctgtatcttcctgacggcagccctt
gggtttcctgaagctttgattcctgtccagttactctgggtcaatctggtgacggatggt
ctgcctgccactgcgctggggttcaatcctccagatctggacatcatgaacaaaccccca
cggaacccaaaagaaccgctgatcagcgggtggctctttttccgttacctggctattggc
tgttatgttggcgctgccaccgtgggtgctgctgcgtggtggttcatcgctgctgacggt
ggtccgagagtctccttctaccagctgagtcatttcctgcagtgtaaggaggacaaccca
gacttcgaaggagtggattgtgcaatctttgagtccccgtatccgatgacaatggcactt
tctgttctagtcaccatagagatgtgcaatgccctcaacagcttgtctgaaaaccagtcc
ctgctgaggatgcccccctgggagaacatctggctcgtgggctccatctgcttgtccatg
tcccttcacttcttgatcctctacgtggaacctttgccactcattttccagatcacaccg
ctgaatctgacccagtggctgatggtgctgaaaatctccctgcctgtgatcctcatggac
gagacgctcaagtttgtggcccgaaactacctggagcctggtaaagagtgtgcgcagcct
gccaccaaaccctcctgctccctgtcggcatgcaccgacggcatttcctggccctttgtg
ctgctcattatgcccctggtggtctgggtctacagcacagacactaactttagtgatatg
ttctggtcttga

DBGET integrated database retrieval system