KEGG   Rattus norvegicus (rat): 116630
Entry
116630            CDS       T01003                                 

Gene name
Csf2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor precursor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno05146  Amoebiasis
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05171  Coronavirus disease - COVID-19
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    116630 (Csf2)
   04668 TNF signaling pathway
    116630 (Csf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116630 (Csf2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    116630 (Csf2)
   04650 Natural killer cell mediated cytotoxicity
    116630 (Csf2)
   04660 T cell receptor signaling pathway
    116630 (Csf2)
   04657 IL-17 signaling pathway
    116630 (Csf2)
   04664 Fc epsilon RI signaling pathway
    116630 (Csf2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    116630 (Csf2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    116630 (Csf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116630 (Csf2)
   05171 Coronavirus disease - COVID-19
    116630 (Csf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116630 (Csf2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    116630 (Csf2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    116630 (Csf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    116630 (Csf2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116630 (Csf2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    116630 (Csf2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     116630 (Csf2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   116630 (Csf2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   116630 (Csf2)
SSDB
Motif
Pfam: GM_CSF M20_dimer
Other DBs
NCBI-GeneID: 116630
NCBI-ProteinID: NP_446304
RGD: 621065
Ensembl: ENSRNOG00000026805
UniProt: P48750
Position
10
AA seq 144 aa
MWLQNLLFLGIVVYSFSAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDII
SNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTF
EDFIKNLKGFLFDIPFDCWKPVQK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagaatttacttttcctgggcattgtggtctacagtttctcagcacccacc
cgctcgcccaaccctgtcacccggccctggaagcatgtagatgccatcaaagaagctctg
agcctcctaaatgacatgcgtgctctggagaacgaaaagaacgaagacgtagacatcatc
tctaatgagttctccatccagaggccgacatgtgtgcagacccgcctgaagctatacaag
cagggtctacggggcaacctcaccaaactcaatggcgccttgaccatgatagccagccac
taccagacgaactgccctccaaccccggaaactgactgtgaaatagaagtcaccaccttt
gaggatttcataaagaaccttaaaggctttctgtttgatatcccttttgactgctggaag
ccggtccagaaatga

DBGET integrated database retrieval system