KEGG   Rattus norvegicus (rat): 116631
Entry
116631            CDS       T01003                                 

Gene name
Nat1
Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00232  Caffeine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    116631 (Nat1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    116631 (Nat1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    116631 (Nat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     116631 (Nat1)
SSDB
Motif
Pfam: Acetyltransf_2 Imm26
Other DBs
NCBI-GeneID: 116631
NCBI-ProteinID: NP_001032392
RGD: 70490
Ensembl: ENSRNOG00000014055
UniProt: P50297 Q45G71
Position
16
AA seq 290 aa
MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLSMHCGEAMCLGLEATFDHIV
RKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVNKYSSEMVHLLVQVTISDRNYI
VDSAYGSSYQMWEPLELTSGKDQPQVPAIFRLTEENGTWYLDQIRREQDVPNQEFVNSDL
LEKSKYRKIYSFTLEPRTIEDFEYVNTYLQTSPASVFVSTSFCSLQTSEGVCCLIGSTLT
SRRFSYKDNVDLVEFKSLTEEEIEDVLKTTFGISLEKKFVPKHGELVFTI
NT seq 873 nt   +upstreamnt  +downstreamnt
atggacatcgaagcatacttcgaaaggattggttacaagaactcagtgaataagttggac
ttggccacattaactgaagttcttcaacaccagatgcgagcagttccttttgagaatctt
agtatgcactgtggagaagccatgtgtctgggcttagaggccacttttgaccacatagta
aggaaaaagcggggtgggtggtgtctccaggttaatcatctgctgtactgggctctgacc
aaaatgggttttgaaaccacaatgttgggaggatatgtttacataactccagtcaacaaa
tatagcagtgaaatggtccaccttctagtacaagtgaccatcagtgacaggaactacatt
gtggattctgcctatggaagctcctaccagatgtgggagcctctggaattaacctcaggg
aaggatcagcctcaggtgcctgccatctttcgtttgacagaagagaatggaacctggtac
ttggaccaaatcagaagagagcaggatgttccaaaccaagagtttgttaactcggacctc
cttgaaaagagcaaatatcgaaaaatctattcctttactcttgagccccgcactattgag
gattttgaatatgtgaatacctaccttcagacatcgccagcctctgtgtttgtaagcaca
tcgttctgttccttgcagacctcagaaggggtttgctgtttaattggttccacccttaca
agtaggagattcagttataaggacaatgtagatctggttgagtttaagagtctgactgag
gaagaaatagaagatgtactgaaaaccacatttggcatttctttggagaaaaagtttgtg
cccaaacatggcgaactcgtttttactatttag

KEGG   Rattus norvegicus (rat): 116632
Entry
116632            CDS       T01003                                 

Gene name
Nat2
Definition
(RefSeq) arylamine N-acetyltransferase 2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00232  Caffeine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    116632 (Nat2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    116632 (Nat2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    116632 (Nat2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     116632 (Nat2)
SSDB
Motif
Pfam: Acetyltransf_2 Imm26 Transglut_core
Other DBs
NCBI-GeneID: 116632
NCBI-ProteinID: NP_446306
RGD: 70492
Ensembl: ENSRNOG00000049498
UniProt: P50298 Q45G59
Position
16
AA seq 290 aa
MDIEAYFERIGYQSSRNKLDLEELTEILQHQIRAIPFENLNIHCGESMELNLEVIFDQVV
RKKRGGWCLQVNHLLYWALTKMGFEATMLGGYVFNTPANKYSSGMIHLLVQVTLSGKDYI
VDAGFGRSYQMWEPLELTSGKDQPQVPAIFRLTEENGTWYLDQIRREQYVPNQEFVNSDL
LEKNKYRKIYSFTLEPRTIEDFESINTYLQTSPASLFTSKSFCSLQTLEGVHCLVGSTLT
YRRFSYKDNIDLVEFKSLTEEEIEDVLKTIFGVSLERKLVPKHGDRFFTI
NT seq 873 nt   +upstreamnt  +downstreamnt
atggacattgaagcatactttgaaagaattggttatcagagttccaggaacaaactggac
ttggaagaattaactgaaattcttcaacaccagatacgggctattccctttgaaaacttg
aacatccattgcggggaatccatggagctgaatttagaagtcatctttgatcaagttgtg
aggaagaagcgtggtggatggtgtctccaggttaatcatctgctgtactgggctctgacc
aaaatgggctttgaagccacaatgttgggagggtatgtctttaacactccagccaataag
tacagcagtggcatgattcacttactagtgcaggtgaccctcagtggaaaggactacatt
gttgatgctgggtttggacgttcctaccagatgtgggagcctctggaattaacatcaggg
aaggatcagcctcaggtgcctgccatctttcgtttgacagaagagaatggaacctggtac
ttggaccaaatcagaagagagcagtatgttccaaaccaagagtttgttaactcagacctc
cttgaaaagaacaaatatcgaaaaatctattcctttactcttgagccccgcactattgag
gattttgagtccattaatacctatcttcagacatcgccagcatccttgtttacaagtaaa
tcattttgttccttgcagaccctagaaggggttcactgtttggttggctccaccctcact
tataggagattcagttataaggacaatatagatcttgtagagtttaagagtctgactgag
gaagaaatagaagacgtactgaaaactatatttggggtttctttagagagaaagcttgtg
cctaaacatggtgatcgattttttaccatttag

KEGG   Rattus norvegicus (rat): 290681
Entry
290681            CDS       T01003                                 

Gene name
Nat3
Definition
(RefSeq) arylamine N-acetyltransferase 3
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00232  Caffeine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    290681 (Nat3)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    290681 (Nat3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    290681 (Nat3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     290681 (Nat3)
SSDB
Motif
Pfam: Acetyltransf_2 HNH
Other DBs
NCBI-GeneID: 290681
NCBI-ProteinID: NP_001013070
RGD: 1307575
Ensembl: ENSRNOG00000029977
UniProt: Q80SX3
Position
16
AA seq 290 aa
MDIEAYFERIGYQKSTNKLDLQTLTEILQHQIRAIPFENLNIHCGKPMELSLEATFHHIV
KKKRGGWCLQVNHLLYWALTMIGFEVTMLGGCVYSPPTCKYSNTMIHLLLQVTISGKKYI
VDSAFPFSCQMWEPLELTSGKDQPQVPAIFHLTEGNGIWYLGQTKRQEFVPNQEFIDSNF
LEKNKHRKIYSFTLEPRTIEDFQNVSAYYQKSPTSVMTNTSLCSLHTQEGVHGLVGTILI
HKKFNYKDNVDLVEFKTLKEEEIEEVLKRVFGIRLETKLVPKCGNWLFTI
NT seq 873 nt   +upstreamnt  +downstreamnt
atggacattgaagcgtactttgaaagaattggttatcagaagtccacgaacaaactggac
ttgcaaacattaactgaaatccttcagcatcagatacgggctatcccttttgagaacttg
aacatccattgtgggaaacccatggaactgagcttagaggccacttttcatcacattgtg
aagaagaagcggggtgggtggtgtcttcaagtcaatcatcttctttactgggctctgacc
atgataggttttgaggtcacaatgttaggaggatgtgtttatagccctccaacctgcaaa
tatagcaacactatgattcaccttctactacaggtgaccatcagtggcaaaaaatatatt
gtagatagtgcattcccattttcctgccagatgtgggagcctctggaattgacatctgga
aaggatcagcctcaggtgcctgccatcttccacttgacagaagggaatggaatttggtat
ctgggacaaactaaaagacaagaatttgttccaaaccaagaattcattgattctaatttt
cttgagaagaacaaacatagaaaaatctactcttttactcttgaacctcgaacgattgaa
gatttccagaacgtgagtgcatactaccagaaatctccaacatctgtgatgacaaacaca
tcactttgctccctgcatacccaagaaggggtccatggtttagtaggcaccattcttatc
cataagaaattcaattataaggacaatgtagatcttgtggagtttaagactctgaaggaa
gaagaaatagaagaagtcctgaagcgcgtttttggtattcgcttggagacaaagcttgtg
cccaaatgtggtaattggctttttactatttag

DBGET integrated database retrieval system