KEGG   Rattus norvegicus (rat): 116633Help
Entry
116633            CDS       T01003                                 

Gene name
Akap8, Akap95
Definition
(RefSeq) A-kinase anchoring protein 8
  KO
K16525  A-kinase anchor protein 8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    116633 (Akap8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AKAP95 zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 116633
NCBI-ProteinID: NP_446307
RGD: 620832
Ensembl: ENSRNOG00000006559
UniProt: Q63014 B2GV93
Position
7q11
AA seq 687 aa AA seqDB search
MEQSYGGYGAWSAGPANTQGTYGSGVASWQGYENYSYYNAQNTSVPTGTPYSYGPASWEA
TKASDGGLAAGSSAMHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGMQ
DRDSSFRFQPYESYDSRPCMPEHTPYRPSYSYDYDFDLGTDRNGSFGGTFNDCRDPTPER
GALDGFLRGRGQGRFQDRSNSSTFIRSDPFMPPSASSEPLSTTWSELNYMGGRGLGGPST
NRPPPSLFSQSMAPDYSMMGMQGVGGFGGTMPYGCGRSQTRIRDWPRRRGFERFGPDNMG
RKRKPFPLYEEPDAKLARADSEGDLSENDDGAGDLRSGDEEFRGEDDLCDSRKQRGEKED
EDEDVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFIS
TKLPDKTVEFLQEYIINRNKKIEKRRQELLEKESPKPKPDPFKGIGQEHFFKRIEAAHCL
ACDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNKHIVKMLEKYLKG
EDPFVNETADLETEGDENLGEEKETPEEVAAEVLAEVITAAVKAVEGDGEPAAEHSDVLA
EVEGPVDTAEAGSDSHTGKLLEEQTCETASETRNMEDMARGEAAEARNEAAVPAAAAGSP
VPVIAIPGILEDELEQTDAEAKDTPTE
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaagctacggaggttatggggcatggagtgctggacctgccaacacccagggt
acatatggaagtggtgtggccagctggcaaggttatgaaaactacagctactacaatgcc
cagaacaccagtgtccctacaggaacaccctatagttatggcccagcctcgtgggaggcc
accaaggccagtgatggtggcctggcagctgggagttctgctatgcatgtggcctctttt
gccccagagccatgcaccgacaactctgactcgctcattgccaagatcaatcaacgtttg
gacatgttgtccaaggaaggaggcaggggtgggatcagcagcggtggggagggcatgcag
gaccgagacagctccttccgcttccagccatatgagtcctacgactccaggccctgtatg
cctgagcatactccctaccgccccagctacagttacgattatgactttgacttgggaact
gaccgcaatggtagttttggcgggacattcaacgactgtcgggacccaaccccagagcga
ggcgcccttgatggtttcttaaggggccggggccagggccgcttccaggaccggagcaac
tcgagcaccttcatacgtagtgaccccttcatgccaccctcagcctcctcagagccctta
tccaccacctggagtgagctgaactacatgggtggacgtggtctaggtgggccctccacc
aacaggccgcctccttccctcttctcccagtccatggcccctgactacagcatgatgggc
atgcagggggtgggcggttttggtggcaccatgccttatggatgtggccggtcccagact
cggatacgggattggcccagaaggagggggtttgaacgctttggaccagacaacatgggc
aggaagcggaagccgtttccattgtatgaagaacctgatgccaagctggcccgtgctgac
agtgaaggagacctctctgaaaacgatgatggagctggtgacttacggtcaggagatgaa
gaatttaggggggaggacgacctctgtgactcccggaagcagagaggagaaaaggaggac
gaggatgaggatgtgaagaagagacgggagaagcaaaggaggagagatcggatgcgggac
cgagcagctgacaggattcagtttgcctgttctgtgtgcaaatttcgtagctttgaagat
gaagaaatccaaaagcatctgcaaagtaaatttcataaagagaccttgcggtttataagt
accaaactacctgacaagacagtagaatttctccaggagtatatcataaacaggaataag
aaaattgagaaacggcgtcaggagttgttggagaaggaaagccctaaacccaaaccagat
ccattcaaagggattggccaggagcatttcttcaaaaggattgaagccgcacactgcctg
gcctgtgacatgctgattcctgcacagcaccagctcctgcagcggcatctgcactctgtg
gaccataaccataatcgaaggttggctgctgaacaattcaagaaaacaagtctccatgtg
gctaagagtgttctgaacaacaagcatatagtgaagatgttagaaaaatacctcaagggc
gaggatccttttgtcaatgaaactgctgatcttgagacagaaggagatgagaacttagga
gaggagaaggagacaccagaggaggtagctgcggaagtcttagcagaggtgatcacagca
gcggtgaaggctgtagagggggatggagaaccagctgcagagcatagtgacgtcctagct
gaagtggaagggcctgtggacaccgccgaggctggtagtgactcccacactggaaagctg
ctagaagaacagacctgtgaaacagcatctgaaaccaggaacatggaagacatggccaga
ggtgaggctgctgaggccagaaatgaagcagctgtgccagcagcagccgccggaagccca
gtacctgtcatagccatcccaggaatcctggaagatgagctggaacaaactgatgcagag
gccaaagatactcccacagaataa

DBGET integrated database retrieval system