KEGG   Rattus norvegicus (rat): 116636
Entry
116636            CDS       T01003                                 

Gene name
Eif4ebp1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno03013  RNA transport
rno04012  ErbB signaling pathway
rno04066  HIF-1 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04218  Cellular senescence
rno04910  Insulin signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05221  Acute myeloid leukemia
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    116636 (Eif4ebp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    116636 (Eif4ebp1)
   04066 HIF-1 signaling pathway
    116636 (Eif4ebp1)
   04151 PI3K-Akt signaling pathway
    116636 (Eif4ebp1)
   04152 AMPK signaling pathway
    116636 (Eif4ebp1)
   04150 mTOR signaling pathway
    116636 (Eif4ebp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    116636 (Eif4ebp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    116636 (Eif4ebp1)
  09149 Aging
   04211 Longevity regulating pathway
    116636 (Eif4ebp1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    116636 (Eif4ebp1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    116636 (Eif4ebp1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    116636 (Eif4ebp1)
   05163 Human cytomegalovirus infection
    116636 (Eif4ebp1)
   05165 Human papillomavirus infection
    116636 (Eif4ebp1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116636 (Eif4ebp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    116636 (Eif4ebp1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     116636 (Eif4ebp1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 116636
NCBI-ProteinID: NP_446309
RGD: 620259
Ensembl: ENSRNOG00000012582
Vega: OTTRNOG00000002142
UniProt: Q62622
Position
16
AA seq 117 aa
MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLME
CRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtcggcgggcagcagttgcagccagactcccagccgggctatccccactcgccgcgta
gccctcggcgacggcgtgcagctcccgcccggggactacagcaccacccccggcggcacg
ctcttcagcaccaccccgggaggaaccagaatcatctatgaccggaaattcctgatggag
tgtcggaactcgcctgtggccaaaacacccccaaaggacctgccaaccattccaggggtc
actagccctaccagcgatgagcctcccatgcaggccagccagagccatctgcacagcagc
ccggaagataagcgggcaggtggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system