KEGG   Rattus norvegicus (rat): 116637
Entry
116637            CDS       T01003                                 

Gene name
Ccl4, Mip1-b, Scya4
Definition
(RefSeq) C-C motif chemokine ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    116637 (Ccl4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116637 (Ccl4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    116637 (Ccl4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    116637 (Ccl4)
   04623 Cytosolic DNA-sensing pathway
    116637 (Ccl4)
   04062 Chemokine signaling pathway
    116637 (Ccl4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    116637 (Ccl4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116637 (Ccl4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   116637 (Ccl4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 116637
NCBI-ProteinID: NP_446310
RGD: 620441
Ensembl: ENSRNOG00000011406
Vega: OTTRNOG00000000488
UniProt: P50230
Position
10q26
AA seq 92 aa
MKLCVSAFSLLLLVAAFCDSVLSAPIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQ
PAVVFLTKKGRQICADPSEPWVNEYVNDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgtctgccttctctctcctcctgcttgtggccgccttctgcgattca
gtgctgtcagcaccaataggctctgaccctcccacttcctgctgcttctcttacacctcc
cggaagattcatcggaactttgtgatggattactatgagaccagcagcctttgctcccag
ccagctgtggtatttctgaccaaaaaaggcaggcaaatctgtgccgaccccagcgagccc
tgggtcaatgagtatgtgaatgacttggagttgaactga

DBGET integrated database retrieval system