KEGG   Rattus norvegicus (rat): 116638
Entry
116638            CDS       T01003                                 

Gene name
Slc17a7, BNPI, Vglut1
Definition
(RefSeq) solute carrier family 17 member 7
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    116638 (Slc17a7)
   04723 Retrograde endocannabinoid signaling
    116638 (Slc17a7)
   04721 Synaptic vesicle cycle
    116638 (Slc17a7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    116638 (Slc17a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116638 (Slc17a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   116638 (Slc17a7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    116638 (Slc17a7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 116638
NCBI-ProteinID: NP_446311
RGD: 620101
Ensembl: ENSRNOG00000020650
Vega: OTTRNOG00000002175
UniProt: Q62634
Position
1q22
AA seq 560 aa
MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPS
YGATHSTVQPPRPPPPVRDY
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagttccggcaggaggagtttcggaagctggcggggcgcgccctggggaggctgcac
cggttactggagaagcggcaggaaggcgcggagacattggagctgagcgccgacgggcgc
ccagtgaccacacacacgcgggacccgccggtggtggactgcacttgctttggcctccct
cgccgctacatcatcgcgatcatgagcggtctgggtttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtatccatggtcaacaacagtacaacccaccgtgggggc
cacgtggtggtgcagaaagcccagttcaactgggatccagagactgtcggcctcatacat
ggctcctttttctgggggtacattgtcactcagattcctggaggatttatctgccaaaaa
ttcgcagccaacagggtctttggctttgccattgtggctacctccaccctaaatatgttg
atcccttcagcagcccgtgttcactatggctgtgtcatcttcgtgaggatccttcaggga
ttggtggagggggtcacataccctgcttgccatggcatctggagcaaatgggcccctccc
ttagaacggagtcggctggcgacgacagccttttgcggttcctatgccggggcagtggtt
gccatgcctctggctggggtcctggtacagtattcaggatggagttctgtcttctatgtc
tatggcagcttcgggatcttttggtacctgttctggttgcttgtctcctacgagtcacct
gcactacaccccagcatctccgaggaggagcgcaaatacattgaggatgccatcggagaa
agcgccaagctcatgaaccctgttacgaagtttaacacaccctggaggcgcttctttacc
tccatgccggtctatgccatcattgtcgccaacttttgccgcagctggactttctacctg
ctcctcatctcccagcccgcctactttgaagaagtgttcggctttgagatcagcaaggtg
ggactggtgtcggcactgcctcaccttgtcatgactatcatcgtacccatcggaggccag
atcgccgacttcctgcgcagtcgtcatataatgtccacgaccaatgtgcgaaagctgatg
aactgcgggggtttcgggatggaagctacgctgctgctggtggtcggatactcacactcc
aagggcgtggccatctccttcctggtcctggctgtgggcttcagtggctttgctatctct
gggtttaacgtgaaccacttggacatcgcccctcgatatgccagcatcttgatgggcatt
tccaatggcgtgggcacactgtctgggatggtgtgccccatcatcgtgggtgcaatgacc
aagcacaagacgcgggaggagtggcagtacgtgttcctcatagcctccctggtgcactat
ggaggtgtcatcttctatggggtctttgcttcgggagagaaacagccgtgggcagagccg
gaggagatgagcgaggagaagtgtggctttgttggccacgaccagctggctggcagtgac
gaaagtgaaatggaagacgaggttgagcccccgggggcaccccccgcacctccgccttcc
tacggggccacacacagcacagttcagcctccaaggcccccaccccctgtccgggactac
tga

DBGET integrated database retrieval system