KEGG   Rattus norvegicus (rat): 116638
Entry
116638            CDS       T01003                                 

Gene name
Slc17a7
Definition
(RefSeq) vesicular glutamate transporter 1
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    116638 (Slc17a7)
   04723 Retrograde endocannabinoid signaling
    116638 (Slc17a7)
   04721 Synaptic vesicle cycle
    116638 (Slc17a7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    116638 (Slc17a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116638 (Slc17a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   116638 (Slc17a7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    116638 (Slc17a7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 116638
NCBI-ProteinID: NP_446311
RGD: 620101
Ensembl: ENSRNOG00000020650
Vega: OTTRNOG00000002175
UniProt: Q62634
Position
1
AA seq 560 aa
MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPS
YGATHSTVQPPRPPPPVRDY
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagttccggcaggaggagtttcggaagctggcggggcgcgccctggggaggctgcac
cggttactggagaagcggcaggaaggcgcggagacattggagctgagcgccgacgggcgc
ccagtgaccacacacacgcgggacccgccggtggtggactgcacttgctttggcctccct
cgccgctacatcatcgcgatcatgagcggtctgggtttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtatccatggtcaacaacagtacaacccaccgtgggggc
cacgtggtggtgcagaaagcccagttcaactgggatccagagactgtcggcctcatacat
ggctcctttttctgggggtacattgtcactcagattcctggaggatttatctgccaaaaa
ttcgcagccaacagggtctttggctttgccattgtggctacctccaccctaaatatgttg
atcccttcagcagcccgtgttcactatggctgtgtcatcttcgtgaggatccttcaggga
ttggtggagggggtcacataccctgcttgccatggcatctggagcaaatgggcccctccc
ttagaacggagtcggctggcgacgacagccttttgcggttcctatgccggggcagtggtt
gccatgcctctggctggggtcctggtacagtattcaggatggagttctgtcttctatgtc
tatggcagcttcgggatcttttggtacctgttctggttgcttgtctcctacgagtcacct
gcactacaccccagcatctccgaggaggagcgcaaatacattgaggatgccatcggagaa
agcgccaagctcatgaaccctgttacgaagtttaacacaccctggaggcgcttctttacc
tccatgccggtctatgccatcattgtcgccaacttttgccgcagctggactttctacctg
ctcctcatctcccagcccgcctactttgaagaagtgttcggctttgagatcagcaaggtg
ggactggtgtcggcactgcctcaccttgtcatgactatcatcgtacccatcggaggccag
atcgccgacttcctgcgcagtcgtcatataatgtccacgaccaatgtgcgaaagctgatg
aactgcgggggtttcgggatggaagctacgctgctgctggtggtcggatactcacactcc
aagggcgtggccatctccttcctggtcctggctgtgggcttcagtggctttgctatctct
gggtttaacgtgaaccacttggacatcgcccctcgatatgccagcatcttgatgggcatt
tccaatggcgtgggcacactgtctgggatggtgtgccccatcatcgtgggtgcaatgacc
aagcacaagacgcgggaggagtggcagtacgtgttcctcatagcctccctggtgcactat
ggaggtgtcatcttctatggggtctttgcttcgggagagaaacagccgtgggcagagccg
gaggagatgagcgaggagaagtgtggctttgttggccacgaccagctggctggcagtgac
gaaagtgaaatggaagacgaggttgagcccccgggggcaccccccgcacctccgccttcc
tacggggccacacacagcacagttcagcctccaaggcccccaccccctgtccgggactac
tga

KEGG   Rattus norvegicus (rat): 25549
Entry
25549             CDS       T01003                                 

Gene name
Slc18a2
Definition
(RefSeq) synaptic vesicular amine transporter
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    25549 (Slc18a2)
   04726 Serotonergic synapse
    25549 (Slc18a2)
   04721 Synaptic vesicle cycle
    25549 (Slc18a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25549 (Slc18a2)
  09165 Substance dependence
   05030 Cocaine addiction
    25549 (Slc18a2)
   05031 Amphetamine addiction
    25549 (Slc18a2)
   05034 Alcoholism
    25549 (Slc18a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25549 (Slc18a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   25549 (Slc18a2)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    25549 (Slc18a2)
SSDB
Motif
Pfam: MFS_1 Sugar_tr LacY_symp S_4TM
Other DBs
NCBI-GeneID: 25549
NCBI-ProteinID: NP_037163
RGD: 3694
Ensembl: ENSRNOG00000008890
UniProt: Q01827 A0A0G2JSJ6
Position
1
AA seq 515 aa
MALSDLVLLRWLRDSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNSTEI
QTTRPELVVSTSESIFSYYNNSTVLITGNATGTLPGGQSHKATSTQHTVANTTVPSDCPS
EDRDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFS
SSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFG
SVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAG
SICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWL
CALLGMVIVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYG
SVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIAFAPLCFFLRSPPAKEEK
MAILMDHNCPIKTKMYTQNNVQSYPIGDDEESESD
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggccctgagcgatctggtgctgctgcgatggctgcgggacagccgccactcgcgcaaa
ctgatcctgttcatcgtgttccttgcgctgctgctggacaacatgctgctcaccgtcgtg
gttcccatcatccccagctatctgtacagcattaagcatgagaaaaactctacggaaatc
cagaccaccagaccagagctcgtggtctccacctccgaaagcatcttctcttactataac
aactctactgtgttgatcaccgggaatgccactgggactcttccaggagggcagtcacac
aaggctaccagcacacagcacactgtggctaacaccactgtcccttcggactgtcccagt
gaagacagagaccttctgaatgagaatgtgcaagttgggctgctgtttgcctccaaagcc
actgtccagctcctcactaacccattcataggacttctgaccaacagaattggctatccg
attcccatgtttgccggcttctgcatcatgtttatctcaacagttatgtttgccttctcc
agcagctatgccttcctgctgatcgccaggtcccttcagggaattggctcctcctgctca
tccgtggctgggatgggtatgctggccagcgtgtacacagatgatgaggagagggggaac
gccatgggcattgctttgggtggcctggccatgggagtcttagtgggaccccccttcggg
agtgtgctctatgaatttgtggggaagacagctcccttcctggtgctagctgccttggtg
ctcttggatggggctattcagctctttgtgctccagccgtcccgagtacagccagagagt
cagaaggggacacctctaacgaccttgctgaaggatccatacatcctcatcgctgcaggc
tccatctgctttgcaaacatggggatagccatgctggagcccgccctgcccatctggatg
atggagaccatgtgttcccgaaagtggcagctgggcgttgctttcctcccggcgagcatc
tcttatctcattggaaccaatatttttgggatacttgcacacaaaatgggaaggtggcta
tgtgctcttctgggaatggtaattgttggaatcagcattttatgcatcccctttgcaaaa
aatatctatggactcatcgctcccaactttggagttggttttgcaattgggatggtggac
tcctctatgatgcctatcatgggctacctggttgacctgcggcatgtgtctgtctatggg
agtgtttatgccattgcagacgtggccttttgtatgggctatgctatcggtccctctgct
ggtggtgccatcgcaaaggcaattggctttccttggcttatgacaattattgggataatt
gatatcgcttttgctccactctgctttttccttcgaagtccacctgctaaggaggaaaaa
atggctatcctcatggaccacaactgtcccattaaaacaaagatgtacactcagaataat
gtccagtcatatcccatcggtgatgatgaagaatctgaaagtgactga

KEGG   Rattus norvegicus (rat): 25693
Entry
25693             CDS       T01003                                 

Gene name
Slc18a1
Definition
(RefSeq) chromaffin granule amine transporter
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    25693 (Slc18a1)
   04726 Serotonergic synapse
    25693 (Slc18a1)
   04721 Synaptic vesicle cycle
    25693 (Slc18a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25693 (Slc18a1)
  09165 Substance dependence
   05030 Cocaine addiction
    25693 (Slc18a1)
   05031 Amphetamine addiction
    25693 (Slc18a1)
   05034 Alcoholism
    25693 (Slc18a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25693 (Slc18a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   25693 (Slc18a1)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    25693 (Slc18a1)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 25693
NCBI-ProteinID: NP_037284
RGD: 3693
Ensembl: ENSRNOG00000011992
UniProt: Q01818 F1LSA7
Position
16
AA seq 521 aa
MLQVVLGAPQRLLKEGRQSRKLVLVVVFVALLLDNMLLTVVVPIVPTFLYATEFKDSNSS
LHRGPSVSSQQALTSPAFSTIFSFFDNTTTTVEEHVPFRVTWTNGTIPPPVTEATSVPKN
NCLQGIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLM
FAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVG
APFGSVMYEFVGKSSPFLILAFLALLDGALQLCILWPSKVSPESAMGTPLLTLLKDPYIL
VAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKM
GRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHT
SVYGSVYAIADVAFCVGFAIGPSTGGVIVQVIGFPWLMVIIGTINIIYAPLCCFLQNPPA
KEEKRAILSQECPTETQMYTVQKPTKEFPLGENSDDPSSGE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgctccaggttgttctgggtgctcctcagcggttgctgaaggaaggaaggcagtcccgc
aagctggtgctggtggtggtgttcgtggctctgcttctggacaacatgctgctcactgtg
gtggtgcccattgtgcccaccttcctgtacgcgacagagttcaaagacagcaactcttct
ctgcataggggtccttctgtaagctcccagcaagctctcacctctcctgccttctctacc
atattctccttctttgacaacaccaccacaactgtagaagaacatgtacccttccgtgta
acttggacaaatggcaccatccctcctccagtcactgaagccacctcagtaccaaaaaac
aactgcttgcaagggatagagttcttagaagaagaaaacgttcggattgggattctattt
gcttcaaaagctttgatgcaacttctggtcaacccatttgtaggacctcttactaacagg
attggctatcacatccccatgtttgttggctttatgatcatgtttctctccacactaatg
tttgctttctctggcacctatgccctgctatttgtggcccgaactctccaaggcattgga
tcttcgttttcatctgttgcaggacttgggatgctggccagtgtctatactgacaactat
gagagagggagagccatgggaattgctttggggggcctggctttgggacttctggtggga
gcacctttcggaagtgtgatgtatgaatttgtgggcaagtcctcaccattcctcatcttg
gccttcttggcacttctggatggagctctccaactttgcatcctgtggccttcgaaagtg
tctcctgagagtgccatggggactccgcttttgacgcttctcaaagacccttacatcctg
gtagcagcaggttccatctgcttggccaacatgggtgtcgccatactagagcccacgctg
cccatctggatgatgcagaccatgtgctcccccgagtggcagctaggtctggctttcttg
cctgctagtgtggcctacctcattggcacgaacctctttggtgtgttggctaacaagatg
ggtcggtggctgtgctcccttgttgggatggtggcagtaggtatcagcttgctctgtgta
cctctggctcacaatatttttggtcttattggccccaatgcaggccttggctttgccata
ggaatggtggattcctctctgatgcccatcatgggatacctggtggacttacgccacacc
tctgtgtatgggagtgtctatgccatcgccgatgtggccttttgtgtgggctttgctatt
ggcccatctactgggggtgttatcgtacaggtcattggctttccttggctcatggtcatc
attggtaccatcaacatcatttatgctcctctctgctgcttcctgcagaacccgccagct
aaggaggagaagcgtgcaattctgagccaggaatgccccacagagacccagatgtacaca
gtccagaagcccacaaaggagtttccactaggagagaacagcgatgatcctagcagcggg
gagtaa

KEGG   Rattus norvegicus (rat): 266767
Entry
266767            CDS       T01003                                 

Gene name
Slc17a8
Definition
(RefSeq) vesicular glutamate transporter 3
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    266767 (Slc17a8)
   04723 Retrograde endocannabinoid signaling
    266767 (Slc17a8)
   04721 Synaptic vesicle cycle
    266767 (Slc17a8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    266767 (Slc17a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    266767 (Slc17a8)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   266767 (Slc17a8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    266767 (Slc17a8)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 266767
NCBI-ProteinID: NP_714947
RGD: 628870
Ensembl: ENSRNOG00000007581
Vega: OTTRNOG00000002178
UniProt: Q7TSF2
Position
7
AA seq 588 aa
MPFNAFDTFKEKILKPGKEGVKNAVGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRA
RAPVCDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAVHPTISNEERTYIETSIGEGANLASL
SKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEEKCGIIDQDELAEETELNHEAFV
SPRKKMSYGATTQNCEVQKTDRRQQRESAFEGEEPLSYQNEEDFSETS
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgccatttaacgcatttgataccttcaaagaaaaaattttgaaacccgggaaggaagga
gtgaagaatgccgtgggagattcgctggggatcttacaaagaaaactcgatgggaccaac
gaggagggagatgccattgagctgagtgaggaaggaaggcctgtgcagacatccagagcc
cgagcccctgtgtgcgactgcagctgctgtggcatccccaagcggtacatcatcgctgtc
atgagtggcctgggattctgcatttcctttgggattcggtgcaaccttggagtggccatt
gtggaaatggtcaacaatagcactgtgtatgtggatgggaaaccggaaatccagacagca
cagtttaactgggatccagagacggtgggtcttatccatggatcttttttctggggttat
attgtgacacaaattcccggtggcttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcttgacgtcaaccctgaacatgttcatcccttccgcggccagggtg
cattacggctgtgtcatgtgtgtgaggattttgcagggtctggtggagggtgtgacctac
ccagcctgccacgggatgtggagtaagtgggcacctcccctggagagaagtcgtctagcc
acaacctctttttgtggttcctatgccggggcagtcgttgctatgccccttgcaggagta
ttggtgcagtacattggctgggcctctgtcttttatatttacgggatgtttggaattatt
tggtacatgttttggctgctgcaggcttatgagtgtccagcagttcacccaacaatatcc
aatgaagaacggacctacatagagacaagtataggagaaggcgccaacttggccagtctg
agcaaattcaacacaccatggagaaggtttttcacatccttgcctgtctatgccattatt
gtggcaaacttttgtagaagctggaccttctatttgctcttaataagtcagcctgcttac
tttgaagaggtctttgggtttgcaataagtaaggtgggtctcttgtcagctgtcccacac
atggtgatgacaatcgtggtacccattggaggacaactggctgattatttaagaagccga
aagattttgaccacaactgctgtcagaaagatcatgaattgtggaggctttggcatggag
gcaaccttgctcctggtggttgggttttcccataccaaaggagtggctatctccttcctg
gtgcttgctgtaggatttagtggctttgcaatttcaggtttcaatgtcaaccacctggac
attgctccacgatatgccagcatcctcatggggatctcaaatggcgtgggaaccctctct
ggaatggtttgtcccctcattgttggtgcaatgaccaagcacaagacccgggaagaatgg
cagaatgtgttcctcatagcagccctggtgcactacagtggagtcatcttctacggggtc
tttgcttctggggaaaaacaggactgggctgatccagagaatctctctgaggagaaatgt
ggaatcattgaccaagatgaattagccgaggaaacagaactcaaccacgaggctttcgta
agtcccagaaagaagatgtcttatggagccaccacccagaattgtgaggtccagaagacg
gatcggagacaacagagagaatccgccttcgagggggaggagccattatcctaccagaat
gaagaggacttttcagaaacatcttaa

KEGG   Rattus norvegicus (rat): 60422
Entry
60422             CDS       T01003                                 

Gene name
Slc18a3
Definition
(RefSeq) vesicular acetylcholine transporter
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    60422 (Slc18a3)
   04721 Synaptic vesicle cycle
    60422 (Slc18a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    60422 (Slc18a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   60422 (Slc18a3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    60422 (Slc18a3)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-GeneID: 60422
NCBI-ProteinID: NP_113851
RGD: 62072
Ensembl: ENSRNOG00000062141
Vega: OTTRNOG00000002353
UniProt: Q62666
Position
16
AA seq 530 aa
MEPTAPTGQARAAATKLSEAVGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGSEGPTLVSEVWEPTLPPPTLANASAYLANTSASPTAAGSARSILRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAVRLREVQGKDGGEPCSPPGPFDGCEDDYNYYSRS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggaacccaccgcgccaaccggtcaggcccgggcggcggccaccaaactgtcggaagcg
gtgggagccgcgctacaagagccccagaggcagcggcgcctggtgctggtcatcgtgtgc
gttgcactgttactggacaacatgttgtacatggtcatcgtgcccattgttcccgactat
atcgcccacatgcgcgggggcagcgagggcccgaccctggtctctgaggtgtgggaaccc
actctgccgccgcccactctggctaatgccagtgcctacttggccaacacgtcggcgtcc
ccgacggctgccgggtcggctcggtcaatcctgcgacctcgctaccccacagaaagcgaa
gatgtgaagataggtgtgctgtttgcctccaaggctatcctgcagcttctggtgaacccc
ttaagcgggcctttcattgatcgcatgagctacgacgtgccgctgcttataggcctgggc
gtcatgttcgcctccacagtcatgtttgcctttgcagaagactatgccacgctcttcgct
gcgcgcagtctacaaggcctgggctcggccttcgcggacacgtctggcattgccatgatc
gccgacaagtatcccgaggagcctgagcgcagtcgtgccctgggcgtggcgctagccttt
attagctttggaagcctagtggcgccaccgtttgggggcatcctctacgagttcgcgggc
aagcgtgtaccctttctagtgctcgccgctgtgtcccttttcgacgcgctcctgctcctg
gcggtggctaagcccttctcggctgcggctcgggcgcgagccaacctgccggtgggcaca
cctatccatcgcctcatgctagacccttacatcgctgtggtagccggcgcgctcaccact
tgtaacattccccttgcgttcctcgagcccaccatagccacgtggatgaagcacacaatg
gccgcatccgagtgggagatgggcatggtttggctgccggctttcgtgccacacgtgtta
ggcgtctacctcaccgtgcgcctggcggcgcgttatccacacctgcagtggctgtacggc
gctctcgggctagcggtaattggagtgagctcttgcgtcgtacctgcctgtcgctcattc
gcgccgttagtggtctcgctctgcggactctgcttcggcatcgcgttagtggacacagcg
ctcctacccacgctcgcctttctggtggacgtgcgccacgtatccgtctatggcagtgtc
tatgccatagctgacatctcctattctgtggcctacgcgctcgggcccatagtggcaggc
cacatcgttcactctcttggctttgagcagctcagcctgggcatgggcctggccaacctg
ctctacgcaccagtccttcttcttttgcgcaatgtaggcctccttacacgctcgcgttcg
gagcgcgatgtgttgcttgatgaaccgccgcagggtctgtacgacgcggtgcgcctgcgt
gaggtgcagggcaaggatggcggcgaaccttgtagcccacctggcccttttgacgggtgc
gaggacgactacaactattactcccgcagctag

KEGG   Rattus norvegicus (rat): 83612
Entry
83612             CDS       T01003                                 

Gene name
Slc32a1
Definition
(RefSeq) vesicular inhibitory amino acid transporter
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04727  GABAergic synapse
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    83612 (Slc32a1)
   04723 Retrograde endocannabinoid signaling
    83612 (Slc32a1)
   04721 Synaptic vesicle cycle
    83612 (Slc32a1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    83612 (Slc32a1)
   05033 Nicotine addiction
    83612 (Slc32a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83612 (Slc32a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   83612 (Slc32a1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 83612
NCBI-ProteinID: NP_113970
RGD: 621402
Ensembl: ENSRNOG00000015393
UniProt: O35458
Position
3
AA seq 525 aa
MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKSEGEPCGDEGAEPPVEGDIHYQRGGAPLPPSGSKDQAVGAGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccaccctgctccgcagcaagctgaccaacgtggccacctctgtgtccaacaagtcc
caggccaaggtgagcggcatgttcgccaggatggggtttcaggcggccacggatgaggag
gcggtgggcttcgcgcactgcgacgatctcgactttgagcaccgccagggcctgcagatg
gacatcctgaaatcggaaggcgagccctgcggggacgagggcgcagaacctcccgtcgag
ggagacattcattatcagcgcggcggcgctcccctgccaccctcgggctccaaggaccag
gccgtgggagctggtggggagttcgggggtcacgacaaacccaagatcacggcgtgggaa
gcgggctggaacgtgacaaacgccattcagggcatgttcgtgctgggtctaccctacgcc
atcctccacggcggctacctggggttgttcctcatcatcttcgccgcggtggtgtgctgc
tacaccggcaagatcctcatcgcgtgcctgtacgaggagaacgaagatggtgaggtggtg
cgcgtgagggactcgtatgtggccatagctaacgcgtgctgcgctcctcgattccccacg
ctgggcggccgcgtggtcaatgtggcccagatcatcgagctggtgatgacgtgtatcttg
tacgtagtggtgagcggcaacctcatgtacaacagtttcccggggctgcccgtgtcgcag
aagtcctggtccatcatagccacggcggtgctgctgccctgcgccttcctgaagaatctc
aaggccgtgtccaagttcagtctgctgtgcacgctggcccacttcgtcatcaacatcctg
gtcatcgcctactgtctctcgcgcgcgcgtgactgggcctgggagaaggtgaagttctac
atcgacgtcaagaagtttcctatctccatcggcatcatcgtgttcagctacacgtcgcag
atcttcctgccctcgctcgaaggcaacatgcagcagcccagcgaattccactgcatgatg
aactggacacacatcgccgcctgcgtgctcaagggtctcttcgcgctcgtcgcctacctc
acctgggccgacgagaccaaggaagtcatcacggataacctgcccggttccatccgcgcc
gtggtcaacatcttcctggtggccaaggcgctgctgtcctacccgttgcccttcttcgcg
gccgtcgaagtgctggagaagtctctcttccaggaaggcagtcgtgccttcttccccgcc
tgctacggtggcgacggtcgccttaagtcctgggggctgacgctgcgctgcgcgctggtg
gtcttcacgctgctcatggccatctacgtgccacacttcgcgctgctcatgggcctcacg
ggcagcctcacgggagccggcctctgcttcctgctgcccagcctcttccacttgcgtctt
ctctggcgcaagctgctgtggcaccaggtcttcttcgatgtggccatcttcgtcatcggc
ggcatctgcagcgtgtccggcttcgtgcattcactcgagggcctcatcgaggcctaccga
accaacgcagaggactag

KEGG   Rattus norvegicus (rat): 84487
Entry
84487             CDS       T01003                                 

Gene name
Slc17a6
Definition
(RefSeq) vesicular glutamate transporter 2
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    84487 (Slc17a6)
   04723 Retrograde endocannabinoid signaling
    84487 (Slc17a6)
   04721 Synaptic vesicle cycle
    84487 (Slc17a6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    84487 (Slc17a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84487 (Slc17a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   84487 (Slc17a6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    84487 (Slc17a6)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 84487
NCBI-ProteinID: NP_445879
RGD: 620531
Ensembl: ENSRNOG00000016147
Vega: OTTRNOG00000002177
UniProt: Q9JI12
Position
1
AA seq 582 aa
MESVKQRILAPGKEGIKNFAGKSLGQIYRVLEKKQDNRETIELTEDGKPLEVPEKKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYALFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggagtcggtaaaacaaaggattttggccccggggaaagaggggataaagaattttgct
ggaaaatccctcggacagatctacagggtgctggagaagaagcaggataaccgagagacc
atcgagctgacagaggacggcaagcccctggaggtgcctgagaagaaggctccgctatgc
gactgtacgtgcttcggcctgccgcgccgctacatcatagccatcatgagcggcctcggc
ttctgcatctcctttggtatccgctgtaacctgggtgtggccattgtggacatggtcaac
aacagcaccatccaccggggtggcaaagttatcaaggagaaagccaagtttaactgggac
cccgagactgtggggatgattcacgggtcgttcttctggggctatatcatcacgcagatt
ccgggcggatacatcgcatcgcgactggctgctaaccgggtctttggggctgccatactg
cttacctctaccctcaatatgctgatcccatctgcagccagagtgcattatggatgcgtc
atctttgttagaatattgcaaggacttgtggagggcgtcacctacccagcctgtcacggg
atatggagcaagtgggcccctcctttggagaggagtaggttggctaccacctccttctgt
ggttcctatgctggagcagtcattgcaatgcccctagctggtatcctggtgcagtacact
ggatggtcttcagtattttacgtatatggaagctttggtatggtctggtatatgttctgg
cttctggtgtcttacgagagccccgcaaagcatccaaccataacagacgaagaacgtagg
tacatagaagagagcatcggggagagcgcaaatctgttaggagcaatggagaaattcaag
accccatggaggaagtttttcacatccatgcccgtctatgcgataattgttgcaaacttc
tgcaggagttggactttttatttactgctcatcagtcaaccagcttatttcgaggaggtt
tttggatttgaaatcagcaaggttggcatgttgtctgcggtcccacacctggtcatgaca
atcattgtgcctatcggggggcaaattgcagactttctaaggagcaagcaaattctttca
acaactacagtgcgaaagatcatgaactgcgggggttttggcatggaagccacactgctt
ctggttgttggctactctcatactagaggggtggccatctccttcttggtgcttgcagtg
ggattcagtggatttgctatctctggtttcaatgtgaaccacttggatattgccccgaga
tatgccagtatcttaatgggcatttcaaatggtgttggcacgctgtcgggaatggtctgc
ccgatcattgttggtgcaatgacgaagaacaagtcccgtgaagaatggcagtatgtcttc
ctcatcgctgcactggtccactatggtggagtcatattttatgcactatttgcctcagga
gagaagcaaccttgggcagaccctgaggaaacaagcgaagaaaagtgtggcttcattcat
gaagatgaactggatgaagaaacgggggacatcactcagaattacataaattacggtacc
accaaatcctacggcgccacctcacaggagaacggaggctggcctaacggctgggagaaa
aaggaagaatttgtgcaagaaagtgcgcaagacgcgtactcctataaggaccgagatgat
tattcataa

DBGET integrated database retrieval system