KEGG   Rattus norvegicus (rat): 116640Help
Entry
116640            CDS       T01003                                 

Gene name
Tnc
Definition
(RefSeq) tenascin C
  KO
K06252  tenascin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05165  Human papillomavirus infection
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    116640 (Tnc)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    116640 (Tnc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116640 (Tnc)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    116640 (Tnc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    116640 (Tnc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    116640 (Tnc)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   116640 (Tnc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin EGF Pur_ac_phosph_N DUF2369 DUF4998 fn3_2 Interfer-bind hEGF
Motif
Other DBs
NCBI-GeneID: 116640
NCBI-ProteinID: NP_446313
RGD: 621057
Ensembl: ENSRNOG00000058645
UniProt: B2LYI9
Position
5q24
AA seq 2019 aa AA seqDB search
MGAVXWLLPGIFLALFALTPEGGVLKKVIRHKRESGLNLTLPEENQPVVFNHVYNIKLPM
GSQCSVDLESTSGEKDLSPTPESSGSFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELEMLVSSLREQCTMGTGCCLQPAEGRLDSRPFCSGRGNFSAEGCGCVCEPGW
KGPNCSEPECPGNCNLRGQCLDGQCICDQGFTGEDCSQLACPNDCNDQGKCVNGVCVCFE
GYAGLDCGLEVCPVPCSEEHGMCVDGRCVCKDGFAGEDCNEPLCFNNCNNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGELTCPNNCQGHGQCEEGQ
CVCNEGFAGADCSEKRCPADCHHHGRCLNGQCECDDGFTGADCGELQCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQRRCPNDCHNRGHCVQGKCICEQGFKGFDCSEMSCPNDCHQHGRC
VNGMCICDDDYTGEDCRDRRCPRDCSQRGRCVDGQCICEDGFTGSDCAELSCPGDCHGHG
RCVNGQCICHEGFTGXDCKEQRCPSDCHGQGRCEDGQCICHEGFTGLDCGQRSCPNDCSN
QGQCVAGRCICNEGYTGVDCSEVSPPKDLIVTEVTEETVBLAWDNEMRVTEYLIMYTPTH
ADGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFAILENKRSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKKVTTTRLDAPSQIEVRDITDTTALITWSKPLAEIDSIELSYGIK
DVPGDRTTIDLTHEDNQYSIGNLKPDTEYEVSLISRRVDMASNPAKETFITGLDAPRNLR
RVSQTDNSITLEWRNVKADIDSYRIKYAPISGGDHAEIDVPKSQQATTKTTLTGLRPGTE
YGVGVSAVKGDKEGDPATINAATEIDAPRDLQVSETTQDSLTLFWKTPLAKFDRYRLNYS
LPTGQSIEIQLPKDATSHVLTDLEPGQEYTVLLTAEKGRHKSKPARVKASTEEVPSLENL
TVTEAGWDGLRLNWTADDLAYEYFVIQVQEANKVETAHNFTVLGNLRTADIPGLKAATPY
RVSIYGVARGYKTPVLSAETFTGKTPSLGEVTVAEVGWDALKLNWTAPEGAYTNFFIQVL
EADMTQTVQNLTVPGGLRSVDLPGLKAATRYYITVRGVTQDFSTAPLSVEVLTEEIPQLG
GLSVTEVSWDSLTLNWTTDDLAYKHFIIQVQEANNVEAAQNLTVSGSLRVVDIPGLKADT
PYRVSIYGVIQGYRTPMLSADVSTAKEPEIGNLNISDVTPESFNLSWTATDGIFDMFTIE
IIDSNRLLQTAEHNISGAERTAHISGLPPSTDFIVYLSGIAPSIRTKTISTTATTEAEPE
VDNLLVSDATPDGFCLSWTADEGIFDSFVIRIRDTKKQSEPQEITLPSPDRTRDITGLRE
ATEYEIELYGISRGRRSQPVSAIATTAMGSPKEIMFSDITENAATVSWRAPTAQVESFRI
TYVPVTGGPPSMVTVDGTDTETRLVRLTPGVEYHVSVIAMKGFEESDPVSGSLITALDGP
SGLLTANITDSEALAMWQPAIATVDSYVISYTGERVPEITRTVSGNTVEFELHDLEPATE
YTLSVFAEKGHQKSSTIATKFTTDLDSPRELTATEVQSETAFLTWRPPRASVTGYLLVYE
SVDGTVKEVIVGPDTTSYSLADLSPSTHYTARIQALSGSLRSKLIQTIFTTIGLLYPFPR
DCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKA
YATGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLK
VEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNN
HSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6060 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtgrcctggctattgccaggcatcttcctagctttgtttgccctcactcct
gaaggtggggtcctcaagaaagtcatcaggcacaagcgagagagtgggctgaacttgacc
ttgccagaggagaatcagccagtggtgttcaaccatgtctacaacatcaagttgcccatg
ggttctcagtgctcagtggatctagagtcaacgagtggagagaaagacctgagccccaca
ccagagtccagtggaagcttccaggagcatacagtggatggggaaaatcagattgtgttc
acacaccgcatcaacatccctcgtcgggcctgtggctgtgccgcagctccagatgtgaag
gagctcctgagcagactggaggaactggagatgttggtatcttctctaagggagcagtgc
accatgggtacaggctgttgcctccaacctgcagaaggccgtctggacagcaggcccttc
tgcagcggcaggggtaacttcagtgctgaaggttgtggctgtgtctgtgaaccaggctgg
aaaggtcccaactgctctgagcctgaatgccctggaaactgtaatctcagaggccagtgc
cttgatggacagtgtatctgtgaccagggtttcactggggaagactgcagccagctagcc
tgtcccaatgactgcaatgaccagggcaagtgtgtgaatggggtctgtgtgtgcttcgaa
ggctatgccggccttgactgtggcctggaagtctgcccagtgccgtgcagcgaggaacac
gggatgtgtgtggatggcaggtgtgtgtgcaaagatggctttgctggtgaagactgcaat
gagcccctttgcttcaacaactgcaacaaccgtgggcggtgtgtggagaacgaatgcgtc
tgtgatgagggcttcacgggcgaagactgcagcgagctcatttgccccaatgactgcttc
gaccgaggtcgctgcatcaacggcacctgctactgtgaagaaggtttcacaggtgaagac
tgtggtgagctcacctgccccaacaactgtcagggccatggccagtgtgaagagggacag
tgtgtttgcaacgagggctttgcaggggcagactgcagtgaaaagcggtgtcccgcagac
tgtcaccaccatggccgctgtctcaacggacagtgtgagtgtgacgatgggttcacaggg
gctgactgtggggaactccagtgccccaatggctgcagtgggcatggccgctgtgtcaat
gggcagtgtgtgtgtgacgagggctacaccggagaagactgtagccaacggcgatgcccc
aatgactgccacaaccggggtcactgtgtacagggcaaatgcatatgtgagcaaggcttc
aaaggctttgactgtagtgagatgagctgtcccaatgactgccaccagcatggccgctgt
gtgaatggcatgtgcatctgtgatgatgactacactggggaagactgcagagaccgccgc
tgtccccgggactgtagccagcgggggcgctgtgtggacggacagtgcatttgtgaggat
ggtttcactggttctgactgtgctgagctctcctgccctggtgactgccacggccatggc
cgctgtgtgaatggccaatgcatctgccacgagggcttcaccggcraagactgcaaagag
caaaggtgccccagtgactgccatggccaaggccgctgtgaggacggccaatgtatctgc
catgagggcttcacaggcctggactgtgggcagcgctcctgtcccaatgactgcagcaac
cagggacaatgtgtggcaggccgctgcatctgcaatgaaggctacacaggggtagactgc
tctgaggtgtcccctcccaaagaccttattgtgacagaagtaacagaggagactgtarat
ctggcatgggacaatgagatgcgggtcactgagtacctcattatgtacacacccacccat
gctgatggcctggagatgcagttccgtgtgcctggggaccagacatctaccaccatccgg
gagctggagccaggagtggagtacttcattcgtgtgttcgccatcttggagaacaagagg
agcatccctgtcagtgccagagttgccacctacttgcctgcacctgaaggcctaaaattc
aagtctatcaaggagacatctgtggaagtagagtgggatcctctggacatcgcttttgaa
acgtgggagatcattttcagaaatatgaacaaagaagatgagggagagatcacaaaaagc
ttgaggaggccagagacctcctaccgccaaactggcctggctcctggccaagaatatgaa
atatctcttcacattgtgaaaaacaacacccgaggccctggcttgaagaaagtgaccaca
actcgcctggatgcccccagccaaattgaggtgagagacatcacagacactacagcactg
atcacctggtccaagcccttggctgaaattgatagcattgagctctcctatggcatcaag
gatgtgcctggagaccggaccaccatcgacctcacacatgaagacaaccagtactccatc
gggaacctgaaacctgacacggagtatgaggtgtccctcatctcccgcagagtggacatg
gcaagcaaccctgccaaggagaccttcatcacaggcctggatgctcccaggaatctccgt
cgcgtctcacagacagacaacagcatcaccttggagtggaggaatgtcaaggcagacatt
gatagttatagaattaagtatgcacctatctctggaggtgaccatgctgagatagatgtt
ccaaagagccagcaagccacaaccaaaaccacactcacaggtctaaggccaggaactgaa
tatggagtgggcgtctctgctgttaagggagacaaggagggcgatccagcaaccatcaat
gcagccacagaaattgatgcacccagggacttacaggtgtctgagaccacacaagacagt
ctgactttattctggaagacacctctggccaagtttgatcgttaccgcctcaactacagc
ctccccacaggccagtcaatagagattcagctgccaaaggatgccacctcccatgtcctg
acagacctggagccagggcaagaatacactgttctcctcaccgctgagaagggcagacat
aagagcaagcctgcgcgtgtgaaggcatccacagaagaagtaccttctctggaaaatctc
accgtgactgaggccggctgggatggcctcagactcaactggactgcagatgacctggcc
tatgagtactttgttattcaggtacaggaagccaacaaggtggagactgctcacaacttc
acagtacttggtaacctccggactgcagacatcccgggcctcaaggctgccactccttat
agagtctccatttatggggtagctcggggctataaaacacccgtgctctctgctgagacc
ttcacagggaaaactcccagtttgggagaggtgactgtggctgaggtgggctgggatgcc
ctcaagctcaactggactgctccagaaggagcctatacgaactttttcattcaggtgcta
gaggctgacatgacccagactgtccagaacctcacagtcccagggggactgaggtcagtg
gacctacctgggctcaaagcagccacccgctattacatcaccgttcgaggggtcacccag
gacttcagcacagcccctctctctgttgaggtcttgacagaggagatccctcaactggga
ggcttgtccgtgactgaggtcagctgggacagccttacactcaactggaccacagatgat
ctggcctataagcactttatcattcaggtgcaggaggccaacaatgtagaggctgctcag
aacctcacagtatctggtagcctcagagttgtggacatcccaggcctcaaggctgatacc
ccttatagagtctccatctatggggtgatccagggctatagaacaccaatgctctctgct
gatgtctccacagccaaagaacctgaaattggaaacttaaatatttctgatgtaactcct
gagagcttcaatctctcctggacagctaccgacgggatcttcgacatgtttactatcgaa
attattgattctaataggttgctgcagacagcagaacataatatatctggtgctgaacga
actgcccacatctcgggccttccacctagtactgatttcattgtctacctctctggaatt
gctcccagcatccgtaccaaaaccatcagtaccacagccaccacagaagctgaaccggaa
gttgacaaccttctagtttcagatgctactccagacggtttctgtctgtcctggactgct
gatgaagggatattcgacagttttgttatcaggatcagagataccaaaaagcaatctgaa
ccacaagaaataaccctcccttcccccgaccgtaccagggacataacaggtctcagagag
gccactgagtacgaaattgaactctatggaataagccgtggaaggcgatcccagccagtc
agtgccatagcaacaacagccatgggctctccgaaggaaatcatgttctcagacatcact
gaaaatgcagccacagtcagctggagggcaccgactgctcaggtggagagtttccggatt
acttatgtgcctgtaacaggaggtcccccatccatggtgaccgtggatgggacggatact
gagacccgactggtgaggctcacccctggagtggagtaccacgtcagtgtgattgccatg
aagggatttgaagaaagtgatccggtctcggggtctctaatcacagctctcgatggtcca
tctggccttctgacagccaacatcacagactcagaagccttggccatgtggcagccggcc
attgccactgtggacagttatgtcatctcctacacaggggagagagtgccagaaattacc
cgcacagtgtctgggaatacagtggagtttgaactacatgacctggagcctgccacagag
tacacactgagtgtctttgcagagaaaggtcaccagaagagttctaccatcgctacgaaa
tttaccacagacctggattccccaagagaattgactgctactgaggttcagtcagaaact
gccttcctcacctggagacctccccgggcatcggtcactggatacctcctggtctatgag
tctgtggatggtacagtcaaggaagtcattgtggggcctgacaccacctcctacagcctg
gcagacctgagcccatccacccactacacagcaagaatccaggcattgagtgggtccctg
aggagcaaactgatccaaaccatcttcaccacaattggactcctatatccattccctagg
gattgctctcaagcaatgttgaatggcgacaccacctctggcctctataccatctatata
aatggtgacaagactcaagcactggaagtctactgtgatatgacctctgatggaggtgga
tggatcgttttcctgagacgcaaaaatggacgtgaggacttctatcgaaactggaaggcc
tatgccactgggtttggagaccgcagagaagaattctggcttggactggataacctgagc
aaaatcacagcccaagggcaatatgagctccgggtggacctacaagaccatggggagtca
gcctatgctgtgtatgacaggttcagtgttggagatgccaagagtcgctacaagctgaag
gtagaaggatacagtggaacggcaggtgactccatgaactatcacaatggtagatccttc
tctacctatgacaaggacacagactcagccatcaccaactgtgccctgtcctacaaagga
gctttctggtataagaactgtcatcgtgtcaacctgatgggcagatatggggacaataat
cacagtcagggtgttaactggttccactggaagggccatgagtactcaatccagtttgcg
gagatgaaactaagacccagcaacttccgaaatctggaaggcaggcgtaagcgggcataa

DBGET integrated database retrieval system