KEGG   Rattus norvegicus (rat): 116650
Entry
116650            CDS       T01003                                 

Gene name
Srp54a
Definition
(RefSeq) signal recognition particle 54 kDa protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    116650 (Srp54a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    116650 (Srp54a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     116650 (Srp54a)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   116650 (Srp54a)
  Eukaryotic Sec-SRP protein
   116650 (Srp54a)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N cobW AAA_33 CbiA DUF2209 SRPRB AAA_17 MeaB AAA_22 AAA_30 MMR_HSR1 AAA_31 APS_kinase MobB ResIII AAA_16 PduV-EutP G-alpha AAA_18 ATP_bind_1 6PF2K Zeta_toxin AAA_28 AAA
Other DBs
NCBI-GeneID: 116650
NCBI-ProteinID: NP_446323
RGD: 621390
Ensembl: ENSRNOG00000032776
UniProt: Q6AYB5
Position
6
AA seq 504 aa
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI
DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK
LAYFYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK
NENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKV
DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI
EGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGL
QSMMRQFQQGAAGNMKGMMGFNNM
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggttctagcagatcttggaagaaaaataacatcagcattacgctcactgagcaatgcc
accattatcaatgaagaggtactaaatgctatgctgaaggaagtgtgtacagcactattg
gaagcagatgttaatattaaactagtgaagcagctgagagaaaatgttaagtctgcgatt
gatcttgaggagatggcgtccggtctgaacaaaaggaagatgattcagcatgctgtgttt
aaagaacttgtaaagcttgtagaccctggagttaaagcatggacaccgactaagggaaag
caaaatgtgatcatgtttgttggattgcaagggagtggtaaaacaacaacgtgttcaaag
ttagcatatttttaccagaggaaaggttggaagacctgtttgatatgtgcagatacattc
agagcaggagcttttgaccagcttaaacagaacgccaccaaagcaagaattccgttctat
ggaagctataccgaaatggatcctgtcatcattgcttctgaaggagtggagaaattcaaa
aatgaaaattttgaaattattattgttgatacaagtggtcgtcacaaacaagaagactcc
ttgtttgaagaaatgcttcaagtttctaacgctatacaacctgataacattgtttatgtg
atggacgcatccattggacaggcttgtgaggcccaggcaaaggccttcaaagataaagta
gatgtagcttcagtaatagtgacgaaacttgatggtcatgcaaaaggaggtggtgctctc
agtgcagttgctgccacaaaaagtccaattattttcattggtacaggagaacatatagat
gactttgaacctttcaaaacacaacctttcattagtaaacttcttggaatgggtgacatt
gaaggactgattgataaagtcaatgagttgaagttggatgataacgaggcacttatagag
aagctgaagcacggtcagtttacattgcgagacatgtatgaacagtttcagaatattatg
aaaatgggcccattcagtcagatcttggggatgattcctggttttggcacagattttatg
agcaaaggaaatgagcaggagtcaatggcaaggctaaagaagctgatgacgataatggac
agtatgaatgatcaagaactggacagtacagatggtgccaaggtttttagtaagcaacca
ggcagaatccaaagagttgcccggggatcaggtgtgtcaacaagagatgtgcaagaactt
ctcacacagtataccaagtttgcccagatggtcaaaaagatgggaggtatcaaagggctt
tttaaaggtggtgatatgtcaaagaatgtgagtcagtcacagatggcaaaattaaatcaa
caaatggccaaaatgatggacccacgagttcttcatcacatgggtggcatggccggcctt
cagtcgatgatgcggcagtttcagcagggtgctgctggcaatatgaaaggcatgatggga
ttcaataacatgtaa

DBGET integrated database retrieval system