KEGG   Rattus norvegicus (rat): 116653Help
Entry
116653            CDS       T01003                                 

Gene name
Cap2
Definition
(RefSeq) CAP, adenylate cyclase-associated protein, 2 (yeast)
  KO
K17261  adenylyl cyclase-associated protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116653 (Cap2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    116653 (Cap2)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    116653 (Cap2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116653 (Cap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP_N CAP_C TBCC
Motif
Other DBs
NCBI-GeneID: 116653
NCBI-ProteinID: NP_446326
RGD: 620310
Ensembl: ENSRNOG00000043350
UniProt: P52481
Position
17p14
AA seq 477 aa AA seqDB search
MADMLGLMQRLEFAVSRLERLSSGLHEPPGGCGEVNSLSRGIVAPSVEAFDKLINSMVAE
FLKNSRVLAGDVETHAEMVHGAFQAQRAFLLMVSQHQQPQENEVAVLLKPISEKIQEIQT
FRERNRGSDMFNHLSAVSESIAALGWIAVSPKPGPYVKEMNDAATFYTNRVLRDYKHSDL
RHVDWVRSYLKIWSELQAYIKEHHTTGLTWSKTGPVASTASAFSILSSGPGLPPPPPPPP
PPGPPPPFENEGGKEEPSPSRSALFAQLNQGEAITKGLRHVTDDKKIYKNPSLRAQGQIR
SPTKTRTPSPTSSKSNSPQKHAPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCD
KSTLQIKGKVNSITVDNCKKFGLVFDHVVGIVEVINSKDIQIQVMGRVPTISINKTEGCH
LYLSKDALDCEIVSAKSSEMNVLVPQGDDYREFPIPEQFKTIWDGSKLITEPAEIMA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatgctgggactgatgcagaggctggaattcgccgtcagccggctcgagcgg
ctgtcctcagggttacacgaacctcccggaggctgtggggaagttaacagcctcagtaga
ggcatagtagcaccatccgtggaagcctttgacaaactgataaacagtatggtggccgag
ttcttaaagaacagccgagtccttgctggcgacgtagagactcacgcggaaatggtacat
ggtgctttccaggcgcagcgtgcttttcttctcatggtctctcagcaccaacaaccccag
gagaatgaagttgctgtccttctgaaacccatatcggagaagattcaagaaatacagaca
ttccgcgagagaaaccgggggagcgacatgttcaaccacctctcggcagtcagcgagagc
atcgccgccctggggtggatagccgtgtctcccaaacctggtccatatgtcaaggagatg
aacgacgccgccaccttttacactaacagggtcctgagggactacaagcacagcgatctg
cgccacgtggattgggtgaggtcctatctcaagatctggagcgaactgcaagcctacatc
aaggagcaccacaccacaggcctcacttggagtaaaactggtcctgtagcatccacagca
tcagcgttttccattctctcctctgggcccggtctccctccaccacctccaccaccacct
cctcctggaccacctcccccttttgagaatgagggcggaaaggaggagccctccccgtct
cgctcagctttgtttgcccagctaaatcagggagaagccatcacaaaagggctccgacat
gtcacggacgacaagaaaatatacaagaatcccagcttgagggcccaaggacaaattcga
tctccaaccaaaacccgcacgccgagccctacatcttcaaaatcgaattctcctcagaaa
catgctccagtgttggagttggaagggaagaaatggagagtggaataccaagaggacagg
aatgaccttgtcatctcagagactgagctaaaacaagtggcgtacattttcaaatgtgac
aaatccactcttcagataaagggaaaagtaaactccatcaccgtcgataactgcaagaag
tttggcctggtgttcgaccatgtggtgggcatcgtggaagtgatcaactccaaggacatt
cagatccaggtaatggggagagtgccaacaatctccattaataagacagaaggatgccac
ctgtacctcagtaaagatgcgctagactgtgagatcgtgagcgccaagtcgtccgagatg
aatgtcctggtccctcagggtgacgattatagagaatttcccattcctgagcagttcaag
acgatatgggacggatccaagctcatcaccgaacctgcagaaatcatggcctga

DBGET integrated database retrieval system