KEGG   Rattus norvegicus (rat): 116655
Entry
116655            CDS       T01003                                 

Symbol
Hnrnpm
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein M isoform b
  KO
K12887  heterogeneous nuclear ribonucleoprotein M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    116655 (Hnrnpm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    116655 (Hnrnpm)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    116655 (Hnrnpm)
SSDB
Motif
Pfam: RRM_1 HnRNP_M_NLS MARF1_RRM1 RRM_3 Collagen_mid RRM_occluded RRM_5
Other DBs
NCBI-GeneID: 116655
NCBI-ProteinID: NP_446328
RGD: 620369
Ensembl: ENSRNOG00000007921
UniProt: Q62826 F1LV13
Position
7:complement(14438703..14476781)
AA seq 690 aa
MAAGVEAAAEVAATEPKMEEESGAPCVPSGNGAPVPKGEERPTQNEKRKEKNIKRGGNRF
EPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKM
EESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKAGRLGSTVFVANLDYKVGWKKL
KEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDE
RALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNKGIGMGNLGPAGMGMEGIG
FGINKIGGMEGPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGAGGSVPG
IERMGPGIDRISGAGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPL
GLDHMASSIERMGQTMERIGSGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGP
AIERMGLSMDRMVPTGMGAGLERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMG
LERMGANSLERMGPAMGPALGAGIERMGLAMGGAGGASFDRAIEMERGNFGGSFAGSFGG
AGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFE
SPEVAERACRMMNGMKLSGREIDVRIDRNA
NT seq 2073 nt   +upstreamnt  +downstreamnt
atggcggcaggggtcgaagcggcggccgaagtggcagcgacagagcccaaaatggaggaa
gagagcggcgcgccctgcgtgccgagcggcaacggagctccggtcccgaagggtgaagaa
cgacctactcagaatgagaagaggaaggagaaaaacataaaaagaggaggcaatcgcttt
gagccatatgcaaacccaactaaaagatacagagccttcattacaaatataccttttgat
gtgaaatggcagtcacttaaagacctggttaaagaaaaagttggtgaggtaacatacgtg
gagctcttaatggacgctgaaggaaagtcaaggggatgtgctgttgttgagttcaagatg
gaggagagcatgaaaaaagctgccgaagttctaaacaagcatagtctgagtggaaggcca
ctgaaagtcaaagaagatcctgatggtgaacatgcaaggagagcaatgcaaaaggctgga
agacttggaagcacagtatttgtagcaaatctggattataaagttggctggaagaaactg
aaagaagtatttagtatggctggtgtggtggtccgagcagacattctggaagataaagat
gggaaaagtcgtggaataggcactgtgacttttgaacagtccattgaagctgtgcaagct
atatctatgtttaatggccagttgctgtttgatagaccgatgcacgtcaagatggatgag
agggctttaccaaagggagacttttttcctcctgaacgcccacagcaacttcctcatgga
cttggtggtatcggtatggggttaggacctggagggcagcctattgatgccaaccacctg
aacaaaggcattggaatgggaaacctaggacctgcaggaatgggaatggaaggcatagga
tttggaataaataaaatcggaggcatggaaggaccctttggtggtggtatggaaaacatg
gggcgatttggatccgggatgaacatgggccggataaatgaaatcctaagtaatgcactg
aagaggggagagatcattgcaaagcaaggaggaggtggagctggaggcagtgtccctggg
atcgaaaggatgggccctggcattgaccgcattagcggtgctggcatggagcgcatgggc
gcaggcttaggccatggcatggatcgagtgggctctgagattgagcgtatgggcctggtc
atggaccgcatgggctcagttgagcgcatgggctccggcatcgagcgcatgggcccacta
ggccttgaccacatggcctccagtattgagcgcatgggccagaccatggaacgcattggt
tctggtgtggagcgcatgggtgccggtatgggcttcggcctggagcgcatggccgcaccc
attgaccgtgtgggccaaaccattgagcgcatgggctctggtgtagagcgcatgggtcct
gccattgagcgaatgggcctaagcatggatcgaatggtgcccacaggcatgggggccggc
ctggagcgcatgggtcctgtgatggatcgtatggccaccggcctggagcgcatgggcgcc
aacaacctggagcgcatgggccttgagcgcatgggagccaacagtcttgagcgcatgggc
ctggaacgaatgggcgccaacagcctggaacggatgggccctgccatgggcccagcattg
ggcgctggtattgagcgaatgggcctggccatgggtggcgccggcggtgctagttttgac
cgagccattgagatggagcggggcaactttggaggaagcttcgcaggttcctttggcgga
gctggaggccatgcacctggagtagccaggaaggcctgccagatatttgtgagaaatctc
ccatttgattttacatggaagatgctaaaggacaaattcaatgaatgtggccacgtgctg
tacgccgacatcaagatggagaacggaaagtccaaggggtgcggtgtggttaagtttgag
tctccagaggtggctgagagagcctgccggatgatgaatggcatgaagctgagtggccga
gagattgatgttcgaattgatagaaacgcttaa

DBGET integrated database retrieval system