KEGG   Rattus norvegicus (rat): 116656
Entry
116656            CDS       T01003                                 

Gene name
Cdc123, D123
Definition
(RefSeq) cell division cycle 123
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: D123 Reg_prop
Other DBs
NCBI-GeneID: 116656
NCBI-ProteinID: NP_446329
RGD: 619766
Ensembl: ENSRNOG00000017770
UniProt: Q62834
Position
17q12.3
AA seq 336 aa
MKKEHVSHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSGREDPPTCSQPDS
GDEAEETQWSDDESTATLTAPEFPEFNTQVQEAINSLGGSVFPKLNWSAPRDAYWIAMNS
SLKCKSLSDIFLLFKSSDFITHDFTQPFIHCNDDSPDPCIEYELVLRKWCELIPGAEFRC
FVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKEHLQYKFLDEDFVFDIYRDSRG
KVWLIDFNPFGEVTDSLLFTWEELTSENNLRGDVSEADALEQDSPAFRCTNSEVTVQPSP
YLSYGLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaagaaggagcatgttagtcactgtcagttctccgcgtggtacccactcttccgaagc
cttaccatcaagagtgtcatcctcccgcttcctcagaatgtgaaagactatttacttgac
gacgggactctggtggtctcaggaagggaagacccaccaacatgctctcagccagacagt
ggtgacgaagcagaggaaacacagtggtccgatgatgagagcacagccacacttacggca
cccgagtttcctgagttcaatactcaagtccaagaagctatcaattcgctggggggcagt
gtcttccctaagcttaactggagtgccccaagggatgcatactggatagcaatgaacagt
tctctgaagtgtaaaagcctcagtgacatcttcctgcttttcaagagttcggacttcatc
actcatgacttcacacagccgtttattcattgtaatgatgattctccagatccttgtata
gagtacgagcttgttctccgaaaatggtgtgaattaatccctggggctgagttccgatgt
tttgtcaaggaaaacaagcttattggtatttctcagagggactacacgcagtactatgat
catatctctaagcaaaaagaagaaatttgcagatgcattcaagactttttcaaggaacac
ctgcagtacaaattcttagatgaagactttgtgtttgatatatacagagacagtaggggc
aaggtgtggctgatcgactttaacccatttggggaggtcacagactctctgctgtttact
tgggaagagctgacatcggagaacaatctgcgaggcgacgtcagtgaggcggacgctctg
gagcaggattctccagccttccgttgtacgaacagtgaagtcacggtccagcccagcccc
tatctgagctacggcctgcccaaggacttcgtagacctttccaccggggaagatgctcac
aagctcatagattttcttaagctgaaaagaaatcagcaagaggacgactga

DBGET integrated database retrieval system