KEGG   Rattus norvegicus (rat): 116657Help
Entry
116657            CDS       T01003                                 

Gene name
Cplx2
Definition
(RefSeq) complexin 2
  KO
K15294  complexin-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116657 (Cplx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116657 (Cplx2)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    116657 (Cplx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaphin LD_cluster2 Spt5_N RR_TM4-6
Motif
Other DBs
NCBI-GeneID: 116657
NCBI-ProteinID: NP_446330
RGD: 70945
Ensembl: ENSRNOG00000000105
UniProt: P84087
Position
17p14
AA seq 134 aa AA seqDB search
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaagccctcggaggggccaccaaggacatggggaagatgctg
gggggagaggaggagaaggacccagatgcacagaagaaggaggaggagcggcaggaggcc
ctgaggcagcaggaggaagagcgcaaggccaaacatgcccgcatggaagcggaacgtgag
aaggtccggcagcagattcgagataagtatgggctgaagaagaaagaagagaaggaggca
gaggagaaggcagccctggaacagccctgcgagggaagcctgaccagacccaagaaggcc
atccctgcaggctgtggggacgaggaggaggaagaagaggagagcatcctggacacggtg
ctcaaatatctgccggggccactgcaggacatgttcaagaagtaa

DBGET integrated database retrieval system