KEGG   Rattus norvegicus (rat): 116657
Entry
116657            CDS       T01003                                 

Gene name
Cplx2
Definition
(RefSeq) complexin-2
  KO
K15294  complexin-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116657 (Cplx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116657 (Cplx2)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    116657 (Cplx2)
SSDB
Motif
Pfam: Synaphin Spt5_N
Other DBs
NCBI-GeneID: 116657
NCBI-ProteinID: NP_446330
RGD: 70945
Ensembl: ENSRNOG00000000105
UniProt: P84087
Position
17
AA seq 134 aa
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaagccctcggaggggccaccaaggacatggggaagatgctg
gggggagaggaggagaaggacccagatgcacagaagaaggaggaggagcggcaggaggcc
ctgaggcagcaggaggaagagcgcaaggccaaacatgcccgcatggaagcggaacgtgag
aaggtccggcagcagattcgagataagtatgggctgaagaagaaagaagagaaggaggca
gaggagaaggcagccctggaacagccctgcgagggaagcctgaccagacccaagaaggcc
atccctgcaggctgtggggacgaggaggaggaagaagaggagagcatcctggacacggtg
ctcaaatatctgccggggccactgcaggacatgttcaagaagtaa

KEGG   Rattus norvegicus (rat): 361342
Entry
361342            CDS       T01003                                 

Gene name
Cplx4
Definition
(RefSeq) complexin-4
  KO
K15295  complexin-3/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    361342 (Cplx4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361342 (Cplx4)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    361342 (Cplx4)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 361342
NCBI-ProteinID: NP_001178764
RGD: 1307643
Ensembl: ENSRNOG00000016928
UniProt: D3ZM85
Position
18
AA seq 160 aa
MAFFVKNMISNQVKNLGFGGGSEEKKEEGGTSDPAAAKGMTREEYEEYQKQMIEEKMERD
AAFTQKKAERACLRVHLRDKYRLPKSEMDETQIQLAGDDVDLPEDLRKMVDEDQDEEEEK
DSILGQLQNLQNMDLDTIKEKAQATFTEIKQSAEQKCSVM
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctttctttgtgaaaaatatgataagtaaccaggtaaagaatttaggatttggaggt
gggtctgaagaaaagaaagaagaaggaggcacctcagaccccgcggcggctaaagggatg
actagagaggaatacgaggaataccagaagcagatgattgaagagaagatggagagagat
gctgcatttactcagaaaaaggctgagagggcatgcctacgagtccacctcagagacaaa
tacaggcttccgaagagtgaaatggacgagacacaaatccagctggctggggacgatgtg
gatttgcccgaggatctccgaaagatggtagacgaggaccaggatgaggaagaggagaag
gattctatcctggggcagttgcagaacctccagaacatggacttggataccattaaagag
aaggcacaagccaccttcacagaaatcaagcagtcagccgaacagaagtgttctgtgatg
tga

KEGG   Rattus norvegicus (rat): 501005
Entry
501005            CDS       T01003                                 

Gene name
Cplx3
Definition
(RefSeq) complexin-3
  KO
K15295  complexin-3/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    501005 (Cplx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    501005 (Cplx3)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    501005 (Cplx3)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 501005
NCBI-ProteinID: NP_001102765
RGD: 1560104
Ensembl: ENSRNOG00000019317
UniProt: D4ABY0
Position
8
AA seq 158 aa
MAFMVKSMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDA
QFTQRKAERATLRSHFRDKYRLPKNETDESQIQLAGGDVELPRELAKMIEEDTEEEEDKA
SVLGQLASLPGLDLSSLKDKAQTTLGDLKQSAEKCHIM
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcgttcatggtgaagtccatggtgggtggccagctgaagaacctcaccggtagcctg
gggggcggcgaggacaagggggacggagacaagtctgcagccgaagcacagggcatgagc
cgagaagagtatgaggagtatcagaagcaactggtggaggagaagatggagcgagacgca
cagttcacacagaggaaggcagaacgggccacgctacggagtcacttcagggacaaatac
cgtctgcccaagaatgagacggatgaaagccagatccagctggcaggcggagatgtggaa
ctgcctcgggagctagccaagatgatcgaggaggacacggaggaagaggaagataaggcc
tctgtgcttgggcagctggccagcctccctggcttggacctcagctcactcaaggacaag
gcccagactacgctaggggacctcaagcaatcagctgagaagtgccatatcatgtga

KEGG   Rattus norvegicus (rat): 64832
Entry
64832             CDS       T01003                                 

Gene name
Cplx1
Definition
(RefSeq) complexin-1
  KO
K15294  complexin-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    64832 (Cplx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64832 (Cplx1)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    64832 (Cplx1)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 64832
NCBI-ProteinID: NP_074055
RGD: 70944
Ensembl: ENSRNOG00000000060
UniProt: P63041
Structure
PDB: 
5W5C 1KIL 5W5D

Position
14
AA seq 134 aa
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
VMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEEDESILDTV
IKYLPGPLQDMFKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggagttcgtgatgaaacaagccctgggaggggccaccaaggatatggggaagatgctt
gggggtgatgaggagaaggaccccgatgccgccaagaaggaggaggagcggcaggaggca
ctgcggcaggcagaggaggagcgcaaagcaaagtatgccaagatggaggcagaacgtgag
gtcatgcggcagggcatacgagataagtatggcatcaagaagaaggaggagcgtgaggct
gaggctcaggcagccatggaggccaactcagaaggcagcctgactcgacccaagaaggct
atcccaccaggctgtggggacgagcccgaggaggaagacgagagcatcctggacactgtc
atcaagtacctgcctgggccactgcaggacatgttcaagaagtaa

DBGET integrated database retrieval system