KEGG   Rattus norvegicus (rat): 116659Help
Entry
116659            CDS       T01003                                 

Gene name
Dync1i2, Dnci2, Dncic2
Definition
(RefSeq) dynein cytoplasmic 1 intermediate chain 2
  KO
K10415  dynein intermediate chain, cytosolic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116659 (Dync1i2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    116659 (Dync1i2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116659 (Dync1i2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    116659 (Dync1i2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    116659 (Dync1i2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      116659 (Dync1i2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     116659 (Dync1i2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 116659
NCBI-ProteinID: NP_001257553
RGD: 620174
Ensembl: ENSRNOG00000009781
UniProt: Q6AZ35
Structure
PDB: 

Position
3q22
AA seq 632 aa AA seqDB search
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAAVSVQEESDLEKKRREA
EALLQSMGLTTDSPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDPSALQLH
SDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVTAQPKEDEEEEDDVAAPKPPVE
PEEEKILKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFD
YSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEEAP
HEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNK
RTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVH
KQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHA
AVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGM
GRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVP
RNDEWARFGRTLAEINASRADAEEEAATRIPA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaaaagtgaattaaaagctgagttggaacgtaagaagcaacggttggcccaa
atcagagaagaaaagaagaggaaagaagaggaaaggaaaaaaaaagaaactgatcagaag
aaggaagctgcagtctctgtgcaggaagagtctgaccttgaaaagaagagaagagaagcc
gaagccttgcttcagagcatggggctaactacagactccccaattgtccctcctcccatg
tctccatcctccaagtcggtgagcacgccaagtgaagctggaagccaggactctggagat
ggcgccgtgggatctaggacgctgcactgggatacagatccatcagctcttcagctccac
tcagattccgatttgggacgaggacctattaaacttggaatggccaaaattactcaagtc
gactttccccctcgagaaatcgtcacatatacaaaggaaactcagaccccggttacagct
caacccaaagaagatgaggaggaggaagatgacgtagcagctcctaagcctcctgttgaa
cctgaagaagagaaaattttaaaaaaagacgaagagaatgatagcaaagctccccctcat
gaactaactgaagaagaaaagcaacaaattttacactcagaagaatttttaagtttcttt
gaccattctacaagaattgtagaaagagccctctctgagcagattaacatcttctttgac
tacagtgggagagatttggaagacaaagaaggggagattcaagcaggtgctaagctgtca
ttaaatcgacagttttttgatgagcgttggtcaaagcatcgagttgttagttgcttggat
tggtcatcccagtatccagaattacttgtggcttcctataataacaatgaagaggctcct
catgagcctgatggtgtggccctcgtatggaatatgaagtacaagaaaactaccccagag
tacgtgttccactgccagtcagctgtaatgtctgctacatttgcaaaatttcatccaaat
cttgttgttggaggtacatactcaggccaaattgtgctttgggataaccgtagcaataaa
agaacccccgtccagagaacaccactgtcagctgctgcacacacacaccctgtctactgt
gtaaatgttgttggaacacaaaatgctcataatctgattagcatctctactgatggaaaa
atttgctcctggagcttagacatgctttcccatccacaggatagcatggagttggttcat
aaacagtcaaaggcagtagctgtaacatctatgtctttccctgttggagacgtcaacaac
tttgttgtgggcagtgaagaaggttctgtgtatacagcatgccgccatggcagcaaagcc
ggaatcagtgagatgtttgagggacaccagggacccatcacgggaatccactgtcacgca
gctgttggcgcagtagacttctcacatctgttcgtcacttcgtcttttgactggacagta
aaactttggacaactaagaataacaagcctttgtactcatttgaagataattcagactat
gtctatgatgttatgtggtcacccacccacccagccctgtttgcctgtgtggatggcatg
gggagactggatctatggaatctcaacaatgacacagaggtgccgactgccagcatttct
gtggagggcaaccctgcccttaaccgtgtgagatggacccactcgggaagagagatcgcc
gtgggtgattctgaaggacagattgtcatatatgatgtgggcgagcagatcgctgttccc
cgaaatgatgaatgggcaagatttggccgaacactcgcagagattaacgcaagccgagct
gatgcagaggaggaagcggctacccggattcctgcctag

DBGET integrated database retrieval system