KEGG   Rattus norvegicus (rat): 116663Help
Entry
116663            CDS       T01003                                 

Gene name
Dusp6, Mkp3
Definition
(RefSeq) dual specificity phosphatase 6
  KO
K21946  dual specificity phosphatase 6 [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116663 (Dusp6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    116663 (Dusp6)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    116663 (Dusp6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    116663 (Dusp6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     116663 (Dusp6)
    3.1.3.48  protein-tyrosine-phosphatase
     116663 (Dusp6)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    116663 (Dusp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase Init_tRNA_PT PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 116663
NCBI-ProteinID: NP_446335
RGD: 70978
Ensembl: ENSRNOG00000023896
UniProt: Q64346
Position
7q13
AA seq 381 aa AA seqDB search
MIDTLRPVPFASEMAISKTVAWLNEQLELGNEQLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTAPSNQNVYQVDSLQST
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatagatacgctcagacccgtgcccttcgcgtcggaaatggcgatcagcaagacggtg
gcgtggctcaacgagcagctggagctgggcaacgaacagctgctgctgatggactgccga
ccgcaggagctgtacgagtcgtcgcacatcgaatctgccatcaacgtggccatcccgggc
atcatgctgcggcgtctgcagaagggcaacctgccggtgcgcgcgctattcacgcgctgc
gaggaccgggaccgctttaccaggcgctgcggcaccgacaccgtggtgctctacgacgag
aacagcagcgactggaatgagaacacaggtggagagtcggtcctcgggctgctgctcaag
aaactcaaagacgagggctgccgggcgttctaccttgaaggtggcttcagtaagttccag
gccgagttcgccctgcactgcgagaccaatctagacggctcgtgcagcagcagctccccg
cccttgccagtgctgggactcgggggcctgaggatcagctccgactcttcctcggacatt
gagtctgaccttgaccgagaccccaatagtgcaacggactccgatggcagcccgctgtcc
aacagccagccttccttcccggtggagattttgcccttcctttacctgggctgtgccaag
gactctactaacttggacgtgttggaagagtttggcatcaagtacatcttgaacgtcacc
cccaatctgcccaatctgtttgagaatgcaggggagttcaagtacaagcaaattcctatc
tctgatcactggagccaaaacctgtcccagtttttccctgaggccatttctttcatagat
gaagcccgaggcaaaaactgtggtgtcctggtgcattgcttggcgggcatcagccgctcc
gtcacggtgacagtggcttaccttatgcagaagctcaacttgtccatgaacgatgcttat
gacattgtcaaaatgaagaagtccaacatctctcccaacttcaacttcatgggccagctg
cttgactttgaaaggaccctgggactcagcagcccctgtgacaatcgtgtccccgcacag
cagctctacttcaccgcgccctccaaccagaatgtctaccaagtggactccctgcaatct
acgtga

DBGET integrated database retrieval system