KEGG   Rattus norvegicus (rat): 116667
Entry
116667            CDS       T01003                                 

Gene name
Map3k1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04530  Tight junction
rno04622  RIG-I-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    116667 (Map3k1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116667 (Map3k1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    116667 (Map3k1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    116667 (Map3k1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    116667 (Map3k1)
   04935 Growth hormone synthesis, secretion and action
    116667 (Map3k1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    116667 (Map3k1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116667 (Map3k1)
   05161 Hepatitis B
    116667 (Map3k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116667 (Map3k1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    116667 (Map3k1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     116667 (Map3k1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   116667 (Map3k1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    116667 (Map3k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 116667
NCBI-ProteinID: NP_446339
RGD: 620966
Ensembl: ENSRNOG00000013177
UniProt: Q62925
Position
2
AA seq 1493 aa
MAAAAGDRASSSGFPGAAAASPEAGGGGGALQGSGAPAAGAGLLRETGSAGRERADWRRQ
QLRKVRSVELDQLPEQPLFLTASPPCPSTSPSPEPADAAAGASGFQPAAGPPPPGAASRC
GSHSAELAAARDSGARSPAGAEPPSAAAPSGREMENKETLKGLHKMDDRPEERMIREKLK
ATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEMSNLAAELQGEGQAGSAAPAPKGRRS
PSPGSSPSGRSGKPESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYSPEETSRRVNK
VMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLFVMLRVFQLEP
SDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNCHTLSSSSTSTSS
SENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPL
CRSKWRSHDFYSHELSSPVDSPTSLRGVQQPSSPQQPVAGSQRRNQESNFNLTHYGTQQI
PPAYKDLAEPWIQAFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGTSGGG
SGGSLSAGAASGSSQPSISGDVVEACCSVLSIVCADPVYKVYVAALKTLRAMLVYTPCHS
LAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVGREILKAGSI
GVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTDVSQAEPVEI
RYKKLLSLLAFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPALFSKLVTMLSASGSSHF
ARMRRRLMAIADEVEIAEVIQLGSEDTLDGQQDSSQALAPPRYPESSSLEHTAHVEKTGK
GLKATRLSASSEDISDRLAGVSVGLPSSATTEQPKPTVQTKGRPHSQCLNSSPLSPPQLM
FPAISAPCSSAPSVPAGSVTDASKHRPQAFVPCKIPSASPQTQRKFSLQFQRTCSENRDS
EKLSPVFTQSRPPPSSNIHRPKPSRPVPGSTSKLGDASKNSMTLDLNSASQCDDSFGSGS
NSGGAVIPSEETAFTPAEDKCRLDVNPELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPE
KAESDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVPQLQVENGEDIIII
QQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRN
TSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYG
AFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKG
TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLA
LIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
NT seq 4482 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggcgatcgcgcctcgtcgtcgggattcccgggcgccgcggcggcg
agccccgaggcgggcggcggcggcggagctctccagggaagcggcgcgcccgcagcgggc
gcggggctgctgcgggagactggcagcgcgggccgcgagcgcgcggactggcggcggcag
cagctgcgcaaagtgaggagtgtggagctggaccagctgccggagcagccgctcttcctc
accgcctcgccgccctgcccatctacttccccgtcgccggagcccgcggacgcggctgca
ggagcgagtggcttccagcctgcggcgggaccgccacccccgggagcagcgagtcgctgc
ggctcccactctgccgagctggcggccgcgcgggacagcggcgcccggagccccgcgggg
gccgagccgccctctgcagcggccccctccggtcgagagatggagaataaagaaaccctc
aaaggattgcacaagatggatgaccgcccagaggagcgaatgatcagggagaagctcaag
gcgacctgtatgcctgcctggaagcacgagtggttagaaaggaggaacaggagaggccct
gtggtggtgaaaccaatccctattaaaggagatggatctgaaatgagtaacttggcagct
gagctccaaggagagggccaggcaggctctgctgcaccagctcccaagggccgacgaagc
ccgtctcctggaagctccccatcagggcgctcagggaagccggaatccccaggagtgaga
cggaaacgagtgtccccagtgcctttccagagtggcagaatcacaccacctcgaagagcc
ccgtcgccagatggcttctcaccgtacagcccagaggagacgagccgccgtgtgaacaaa
gtgatgagggccaggctgtacctcctgcagcagataggacccaactctttcctgattgga
ggagacagtccagacaataaataccgcgtgtttattgggccacagaactgcagctgtggg
cgtgggacattctgcattcacctcttgtttgtcatgctccgggtgttccagctagaaccc
tccgaccccatgctatggagaaaaactttaaaaaattttgaggttgagagtttgttccag
aaataccacagtaggcgtagctcaagaatcaaagctccatctcggaacaccatccagaag
tttgtctcacgcatgtcaaactgtcacacattgtcatcgtctagcacatccacatctagt
tcagaaaacagcatcaaggatgaagaggagcagatgtgtcccatctgcttgttgggcatg
ctggatgaggagagcctgactgtgtgtgaagacggctgcaggaacaagctgcaccaccac
tgcatgtcaatctgggcagaagaatgtagaagaaatagagaaccgttaatatgtcccctt
tgtagatctaagtggagatcccatgacttctacagccatgagttatcaagccctgtggat
tcccctacctccctgcgaggtgtacagcagccctcctccccgcaacagcctgtggccgga
tcacagcggaggaatcaggaaagcaattttaaccttactcattatggaacccagcagatt
cctcccgcttacaaagatttagccgagccatggattcaggcattcggaatggagctcgtt
ggctgcttattctctagaaactggaacgtaagggagatggcccttaggcgcctttcccac
gatgttagcggggccctgttgttggcgaacggggagagcactggaacttctggaggcggc
agcggaggcagcctaagtgctggcgccgccagtgggtcttcccagcccagcatctcaggg
gacgtggtggaggcgtgctgcagcgtcctgtctatcgtgtgcgctgaccctgtctacaaa
gtgtacgttgctgctttaaaaacactgagagccatgctggtatacactccttgccacagc
ctggcagaaagaatcaaacttcagagacttctccggccagtggtagacaccatcctagtg
aagtgcgcagacgccaatagccgcacgagtcagctgtccatatcaacactgttggagctc
tgcaagggccaagcgggggagttggcagttggacgagaaatacttaaagctggatccatc
ggtgttggtggcgttgattacgtcttaagttgtattcttggaaaccaagctgaatcaaac
aactggcaagaactcctgggtcgcctctgtcttatagacagattgctcttggaatttcct
gcggaattttatcctcatattgtcagtaccgatgtctcacaagccgagcctgttgaaatc
aggtataagaagctgctgtccctcttagcctttgccttgcaatccattgacaattcccac
tctatggtcggcaaactctcgcggaggatttatctgagctcagcacgaatggtgaccaca
gtgcccgccctgttttccaagctggtaaccatgctaagtgcttctggatcctcccacttc
gccaggatgcgccggcgtctgatggccattgcagacgaggtagaaattgccgaggtcatc
cagctgggttcggaagacactttggatggccagcaggacagctcgcaggcattggcccct
ccccgctatccagagagcagctcccttgagcacacagcccatgtagagaaaactggaaaa
ggattaaaagctacgagactgagtgccagctcagaggacatttctgacagactggctggc
gtttctgtaggacttcctagttcagcaacaacagaacaaccaaagccaacagttcaaaca
aaaggcagaccccacagtcagtgtttgaactcctctcctttgtctcctcctcagttaatg
tttccagcaatatcagccccatgttcatctgccccgtctgtcccagctggctctgtaaca
gatgcttctaagcatagacctcaggcgtttgttccctgtaaaataccctctgcgtctccc
caaacacagcgcaagttttccctacagttccagaggacctgctctgagaaccgagactca
gaaaaactctccccagtctttactcagtcgagacccccaccctccagtaacatacacagg
ccaaagccatcccgacccgttccgggtagcacaagcaaactaggggatgcctcaaagaac
agcatgacactcgacctgaacagtgcttcccagtgtgatgacagctttggcagtggcagc
aacagtggcggcgccgtcatacccagtgaggagacggcattcaccccagcagaggacaag
tgcaggttagatgtcaaccccgagctcaactccagtatcgaggaccttcttgaagcatct
atgccttcaagtgacacaacagtcactttcaagtccgaagtcgccgtcctctctcctgag
aaggccgaaagtgatgacacctacaaagatgacgtcaatcacaatcaaaagtgcaaagag
aagatggaggctgaggaagaggaggcgctcgcgattgccatggcaatgtcggcttctcag
gacgccctccccatagtccctcagctgcaggtggaaaatggagaggatatcatcatcatc
cagcaggatacaccagaaaccctaccagggcataccaaagcgaagcagccctacagagaa
gacaccgagtggctgaaagggcagcagataggcctcggagcattttcttcttgttaccaa
gcacaggatgtgggcactggaactttaatggctgtgaaacaggtgacctacgtcagaaac
acatcttctgagcaggaggaagtggtggaagccttgagggaagagatcaggatgatgagc
cacctcaaccatccgaacatcatcaggatgctgggggccacgtgcgagaagagcaactac
aacctcttcatcgagtggatggcgggaggctccgtggctcacctcttgagtaaatatgga
gctttcaaggagtcagtggtcattaactacacagagcagttactccgtggcctttcctat
ctccacgagaaccagatcattcacagagacgtcaaaggggccaatctgctcattgacagc
accggtcagcggctgagaattgcagacttcggtgctgccgccaggttggcatccaaagga
actggtgcaggagagttccagggacagttactggggacaattgcattcatggcgcctgag
gtactaagaggtcagcagtacggtaggagctgtgacgtctggagtgttggctgcgccatt
atagaaatggcctgtgcaaaaccaccctggaacgcagaaaagcactccaatcatcttgct
ttgatatttaagattgcgagtgcaactactgcaccatccatcccgtcacacctgtccccg
ggcctgcgagacgtggctctgcgctgtttagaacttcaacctcaggacagacctccgtca
agagagctactgaagcatcctgtcttccgtacaacatggtag

DBGET integrated database retrieval system