KEGG   Rattus norvegicus (rat): 116667
Entry
116667            CDS       T01003                                 

Gene name
Map3k1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04530  Tight junction
rno04622  RIG-I-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    116667 (Map3k1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116667 (Map3k1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    116667 (Map3k1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    116667 (Map3k1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    116667 (Map3k1)
   04935 Growth hormone synthesis, secretion and action
    116667 (Map3k1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    116667 (Map3k1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116667 (Map3k1)
   05161 Hepatitis B
    116667 (Map3k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116667 (Map3k1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    116667 (Map3k1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     116667 (Map3k1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   116667 (Map3k1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    116667 (Map3k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 116667
NCBI-ProteinID: NP_446339
RGD: 620966
Ensembl: ENSRNOG00000013177
UniProt: Q62925
Position
2
AA seq 1493 aa
MAAAAGDRASSSGFPGAAAASPEAGGGGGALQGSGAPAAGAGLLRETGSAGRERADWRRQ
QLRKVRSVELDQLPEQPLFLTASPPCPSTSPSPEPADAAAGASGFQPAAGPPPPGAASRC
GSHSAELAAARDSGARSPAGAEPPSAAAPSGREMENKETLKGLHKMDDRPEERMIREKLK
ATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEMSNLAAELQGEGQAGSAAPAPKGRRS
PSPGSSPSGRSGKPESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYSPEETSRRVNK
VMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLFVMLRVFQLEP
SDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNCHTLSSSSTSTSS
SENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPL
CRSKWRSHDFYSHELSSPVDSPTSLRGVQQPSSPQQPVAGSQRRNQESNFNLTHYGTQQI
PPAYKDLAEPWIQAFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGTSGGG
SGGSLSAGAASGSSQPSISGDVVEACCSVLSIVCADPVYKVYVAALKTLRAMLVYTPCHS
LAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVGREILKAGSI
GVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTDVSQAEPVEI
RYKKLLSLLAFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPALFSKLVTMLSASGSSHF
ARMRRRLMAIADEVEIAEVIQLGSEDTLDGQQDSSQALAPPRYPESSSLEHTAHVEKTGK
GLKATRLSASSEDISDRLAGVSVGLPSSATTEQPKPTVQTKGRPHSQCLNSSPLSPPQLM
FPAISAPCSSAPSVPAGSVTDASKHRPQAFVPCKIPSASPQTQRKFSLQFQRTCSENRDS
EKLSPVFTQSRPPPSSNIHRPKPSRPVPGSTSKLGDASKNSMTLDLNSASQCDDSFGSGS
NSGGAVIPSEETAFTPAEDKCRLDVNPELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPE
KAESDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVPQLQVENGEDIIII
QQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRN
TSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYG
AFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKG
TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLA
LIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
NT seq 4482 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggcgatcgcgcctcgtcgtcgggattcccgggcgccgcggcggcg
agccccgaggcgggcggcggcggcggagctctccagggaagcggcgcgcccgcagcgggc
gcggggctgctgcgggagactggcagcgcgggccgcgagcgcgcggactggcggcggcag
cagctgcgcaaagtgaggagtgtggagctggaccagctgccggagcagccgctcttcctc
accgcctcgccgccctgcccatctacttccccgtcgccggagcccgcggacgcggctgca
ggagcgagtggcttccagcctgcggcgggaccgccacccccgggagcagcgagtcgctgc
ggctcccactctgccgagctggcggccgcgcgggacagcggcgcccggagccccgcgggg
gccgagccgccctctgcagcggccccctccggtcgagagatggagaataaagaaaccctc
aaaggattgcacaagatggatgaccgcccagaggagcgaatgatcagggagaagctcaag
gcgacctgtatgcctgcctggaagcacgagtggttagaaaggaggaacaggagaggccct
gtggtggtgaaaccaatccctattaaaggagatggatctgaaatgagtaacttggcagct
gagctccaaggagagggccaggcaggctctgctgcaccagctcccaagggccgacgaagc
ccgtctcctggaagctccccatcagggcgctcagggaagccggaatccccaggagtgaga
cggaaacgagtgtccccagtgcctttccagagtggcagaatcacaccacctcgaagagcc
ccgtcgccagatggcttctcaccgtacagcccagaggagacgagccgccgtgtgaacaaa
gtgatgagggccaggctgtacctcctgcagcagataggacccaactctttcctgattgga
ggagacagtccagacaataaataccgcgtgtttattgggccacagaactgcagctgtggg
cgtgggacattctgcattcacctcttgtttgtcatgctccgggtgttccagctagaaccc
tccgaccccatgctatggagaaaaactttaaaaaattttgaggttgagagtttgttccag
aaataccacagtaggcgtagctcaagaatcaaagctccatctcggaacaccatccagaag
tttgtctcacgcatgtcaaactgtcacacattgtcatcgtctagcacatccacatctagt
tcagaaaacagcatcaaggatgaagaggagcagatgtgtcccatctgcttgttgggcatg
ctggatgaggagagcctgactgtgtgtgaagacggctgcaggaacaagctgcaccaccac
tgcatgtcaatctgggcagaagaatgtagaagaaatagagaaccgttaatatgtcccctt
tgtagatctaagtggagatcccatgacttctacagccatgagttatcaagccctgtggat
tcccctacctccctgcgaggtgtacagcagccctcctccccgcaacagcctgtggccgga
tcacagcggaggaatcaggaaagcaattttaaccttactcattatggaacccagcagatt
cctcccgcttacaaagatttagccgagccatggattcaggcattcggaatggagctcgtt
ggctgcttattctctagaaactggaacgtaagggagatggcccttaggcgcctttcccac
gatgttagcggggccctgttgttggcgaacggggagagcactggaacttctggaggcggc
agcggaggcagcctaagtgctggcgccgccagtgggtcttcccagcccagcatctcaggg
gacgtggtggaggcgtgctgcagcgtcctgtctatcgtgtgcgctgaccctgtctacaaa
gtgtacgttgctgctttaaaaacactgagagccatgctggtatacactccttgccacagc
ctggcagaaagaatcaaacttcagagacttctccggccagtggtagacaccatcctagtg
aagtgcgcagacgccaatagccgcacgagtcagctgtccatatcaacactgttggagctc
tgcaagggccaagcgggggagttggcagttggacgagaaatacttaaagctggatccatc
ggtgttggtggcgttgattacgtcttaagttgtattcttggaaaccaagctgaatcaaac
aactggcaagaactcctgggtcgcctctgtcttatagacagattgctcttggaatttcct
gcggaattttatcctcatattgtcagtaccgatgtctcacaagccgagcctgttgaaatc
aggtataagaagctgctgtccctcttagcctttgccttgcaatccattgacaattcccac
tctatggtcggcaaactctcgcggaggatttatctgagctcagcacgaatggtgaccaca
gtgcccgccctgttttccaagctggtaaccatgctaagtgcttctggatcctcccacttc
gccaggatgcgccggcgtctgatggccattgcagacgaggtagaaattgccgaggtcatc
cagctgggttcggaagacactttggatggccagcaggacagctcgcaggcattggcccct
ccccgctatccagagagcagctcccttgagcacacagcccatgtagagaaaactggaaaa
ggattaaaagctacgagactgagtgccagctcagaggacatttctgacagactggctggc
gtttctgtaggacttcctagttcagcaacaacagaacaaccaaagccaacagttcaaaca
aaaggcagaccccacagtcagtgtttgaactcctctcctttgtctcctcctcagttaatg
tttccagcaatatcagccccatgttcatctgccccgtctgtcccagctggctctgtaaca
gatgcttctaagcatagacctcaggcgtttgttccctgtaaaataccctctgcgtctccc
caaacacagcgcaagttttccctacagttccagaggacctgctctgagaaccgagactca
gaaaaactctccccagtctttactcagtcgagacccccaccctccagtaacatacacagg
ccaaagccatcccgacccgttccgggtagcacaagcaaactaggggatgcctcaaagaac
agcatgacactcgacctgaacagtgcttcccagtgtgatgacagctttggcagtggcagc
aacagtggcggcgccgtcatacccagtgaggagacggcattcaccccagcagaggacaag
tgcaggttagatgtcaaccccgagctcaactccagtatcgaggaccttcttgaagcatct
atgccttcaagtgacacaacagtcactttcaagtccgaagtcgccgtcctctctcctgag
aaggccgaaagtgatgacacctacaaagatgacgtcaatcacaatcaaaagtgcaaagag
aagatggaggctgaggaagaggaggcgctcgcgattgccatggcaatgtcggcttctcag
gacgccctccccatagtccctcagctgcaggtggaaaatggagaggatatcatcatcatc
cagcaggatacaccagaaaccctaccagggcataccaaagcgaagcagccctacagagaa
gacaccgagtggctgaaagggcagcagataggcctcggagcattttcttcttgttaccaa
gcacaggatgtgggcactggaactttaatggctgtgaaacaggtgacctacgtcagaaac
acatcttctgagcaggaggaagtggtggaagccttgagggaagagatcaggatgatgagc
cacctcaaccatccgaacatcatcaggatgctgggggccacgtgcgagaagagcaactac
aacctcttcatcgagtggatggcgggaggctccgtggctcacctcttgagtaaatatgga
gctttcaaggagtcagtggtcattaactacacagagcagttactccgtggcctttcctat
ctccacgagaaccagatcattcacagagacgtcaaaggggccaatctgctcattgacagc
accggtcagcggctgagaattgcagacttcggtgctgccgccaggttggcatccaaagga
actggtgcaggagagttccagggacagttactggggacaattgcattcatggcgcctgag
gtactaagaggtcagcagtacggtaggagctgtgacgtctggagtgttggctgcgccatt
atagaaatggcctgtgcaaaaccaccctggaacgcagaaaagcactccaatcatcttgct
ttgatatttaagattgcgagtgcaactactgcaccatccatcccgtcacacctgtccccg
ggcctgcgagacgtggctctgcgctgtttagaacttcaacctcaggacagacctccgtca
agagagctactgaagcatcctgtcttccgtacaacatggtag

KEGG   Rattus norvegicus (rat): 171492
Entry
171492            CDS       T01003                                 

Gene name
Map3k2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04540  Gap junction
rno04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    171492 (Map3k2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    171492 (Map3k2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    171492 (Map3k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171492 (Map3k2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     171492 (Map3k2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   171492 (Map3k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 ABC1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 171492
NCBI-ProteinID: NP_612512
RGD: 620967
Ensembl: ENSRNOG00000014089
UniProt: F1M9D0
Position
18
AA seq 619 aa
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKPSSPKKQNDVRVKFEHRGEKRILQVT
RPVKLEDLRSKSKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
LNGSTQATNLEPSPSPDDLNNTPLGAERKKRLSVVGPPNRDRSSPPPGYIPDELHQIARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSFRSPVS
FSPTDHSLSTSSGSSIFTPEYEDSRIRRRGSDIDNPTLTVTDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFNPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVE
AKLRPSAEELLRHLFVHCH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaattcaatcatgcaagatttggctgtccttcataaggcc
agtcggccagcattatctttacaagaaaccagaaaagcaaaaccctcttcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatcttgcaggttact
agaccagttaaactagaagatctgaggtctaagtctaaaattgcctttggacagtctatg
gatctacactataccaacaacgagttggtaattccgttaactacccaagatgacttggac
aaagctgtggaactgctggatcgcagtatccacatgaagagtctcaagatattacttgtt
ctaaatgggagtacacaggctactaatttagagccgtcaccatcaccagacgatctgaat
aatacaccactcggtgcggagaggaaaaagcggctatctgtagtaggtccccctaatagg
gatagaagttctccacccccaggatacattccagatgaactgcaccagattgcccggaac
gggtctttcaccagcatcaacagtgaaggagagttcatcccagagagcatggaccaaatg
ctggatccactgtctttaagcagccctgaaaactctggctcaggaagctgcccgtcactg
gatagtcctttggatggagaaagctacccaaaatcacggatgcctagggcacagagctac
ccagataatcatcaggagttttcagactatgataaccccatttttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcataccatcatcaagagtataatgatggt
cggaagacttttccaagagccagaaggacccagggcaccagtttccggtctcctgtgagt
ttcagtcctactgatcactccttaagcactagtagtgggagcagcatctttaccccagag
tatgaagacagtcggataagaagacgggggagtgacatagacaatcctactttgactgtc
acagacatcagcccacccagccgttcacctcgagctccaaccaactggagattgggcaaa
ctgcttggccaaggagcttttggaagggtctacctctgttatgatgttgataccggacga
gaactggctgttaaacaagttcagtttaaccctgacagccccgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgttgaaaaacttgttgcatgagcgaattgttcag
tattatggctgtctgagggatcctcaggagaaaacactttccatctttatggagtacatg
ccagggggctcaattaaggaccaactcaaagcatatggagcccttactgagaatgtgacg
aggaaatacacccgtcagattctggagggggtccattacctgcatagtaatatgattgtc
catagagacatcaaaggagcgaatatcttaagggattccacgggcaatatcaagctagga
gactttggagctagcaaacgacttcagaccatctgtctctcaggcacagggatgaagtct
gtcacaggcacgccatattggatgagtcctgaggtcattagtggagaaggctatggcaga
aaagcagatatctggagcgtagcatgtacggtggtggagatgctaactgaaaagccacct
tgggctgaatttgaagcaatggctgccatctttaagatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgggactttctcaaacggatttttgtagag
gccaaactccgaccttcagccgaggagctcctgcggcacctgttcgtgcattgccactag

KEGG   Rattus norvegicus (rat): 303604
Entry
303604            CDS       T01003                                 

Gene name
Map3k3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno05166  Human T-cell leukemia virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    303604 (Map3k3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    303604 (Map3k3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    303604 (Map3k3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    303604 (Map3k3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    303604 (Map3k3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    303604 (Map3k3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     303604 (Map3k3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   303604 (Map3k3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 ABC1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 303604
NCBI-ProteinID: NP_001100528
RGD: 1304575
Ensembl: ENSRNOG00000061424
UniProt: B5DF98
Position
10
AA seq 626 aa
MDEQEALDSIMKDLVALQMSRRPRVSGYETMKNKDTGHPNRQSDVRIKFEHNGERRIIAF
SRPVRYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSASMKSLRILL
LSQDRNHTSSSPHSGVSRQVRVKPSQSAGDINTIYQAPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSQMSRARSFPDNRKECSDRETQLYDKGVKGGTYPRRYHVSVHHKDYNDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGAAVQYLDPRGRLRSADSENALTVQERSVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLVY
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggatgaacaagaggcattagactcaatcatgaaggacctggtggccctccagatgagc
cgacgtccccgggtgtctggatatgagaccatgaagaacaaggacacaggtcacccaaac
aggcagagtgacgtcagaatcaagtttgaacacaatggggagagacgaattatagcattc
agccggcctgtgagatatgaagatgtggaacacaaggtgacaacggtctttgggcagcct
cttgatttgcattatatgaataatgagctctccatcctgttgaaaaaccaagatgatctc
gataaagcaattgacattttggatagaagcgcgagtatgaaaagccttaggatactactg
ttatcccaagacagaaaccatactagttcctctccccactctggagtgtccaggcaggtt
cgggtcaagccttcccagtctgcaggggatataaataccatctaccaagctcctgagccc
agaagcaggcacctctctgtcagctcccagaaccctggccgaagctctcctccccctggt
tatgtacctgagcgacaacagcacattgcccggcagggatcatatacgagcatcaatagt
gaaggtgaattcatcccagagaccagcgagcagtgcatgctagatcccctgagcagtgcc
gaaaattccttgtcaggaagctgccaatccttggacaggtcagcagacagcccatctttc
aggaaatcacaaatgtcccgagcccggagcttcccagacaacagaaaggaatgctcggat
cgggagacccagctctatgataaaggagttaaaggcggaacctatcccaggcgttaccat
gtatctgtgcatcataaagactacaatgatggcagaagaacgtttccccgaatacgacgg
caccagggcaacctattcactctggtgccctcaagtcgctccttgagcacaaatggcgag
aacatgggtgccgctgtgcagtacttggacccccgcgggcgcctacggagtgcagacagt
gaaaatgccctcactgtgcaggaaagaagtgtgccaaccaagtctcctagtgctcccatc
aattggcgtcgggggaagctcctgggtcaaggtgccttcggcagggtctacttatgctat
gatgtggacacaggacgtgaacttgcttctaagcaggttcagtttgacccagatagtcct
gagactagcaaggaggtgagtgctctggagtgcgagatccagttgctgaagaacttgcag
catgagcgcatcgtgcagtactatggctgcctgcgggaccgtgctgagaagatcctcacc
atctttatggagtatatgccagggggctctgtaaaagaccagttgaaggcctacggagct
ctgacggagagtgtgacccgcaagtatacacggcagatcctggagggcatgtcctacctg
cacagcaacatgatcgtgcatcgtgacatcaagggagccaatatcctccgagactcggct
gggaatgtgaagcttggggattttggggccagcaaacgcctgcaaaccatctgcatgtca
gggacaggcatgcgctctgtcactggcacaccctactggatgagtcctgaagtcatcagt
ggcgagggctatggaagaaaggcagatgtgtggagcctgggctgtaccgtggtggagatg
ctgacagagaaaccaccttgggcagagtatgaagctatggctgccattttcaagattgcc
acccagcctaccaatcctcagctgccctctcacatctcagaacacggcagggacttcctg
aggcgcatatttgtggaagctcgtcagagaccctcggctgaggagctgctcacacaccac
tttgcacagctagtgtactga

KEGG   Rattus norvegicus (rat): 308106
Entry
308106            CDS       T01003                                 

Gene name
Map3k4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    308106 (Map3k4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    308106 (Map3k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308106 (Map3k4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     308106 (Map3k4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   308106 (Map3k4)
SSDB
Motif
Pfam: MEKK4_N Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 308106
NCBI-ProteinID: NP_001100926
RGD: 1311192
Ensembl: ENSRNOG00000017419
UniProt: D3ZGU6
Position
1
AA seq 1387 aa
MNTPSQSPHKDLGKGVEAVEEYSYKQGKKTRATLRTTERDHKKNAQCSFMLDSVAGSLPK
KSIPDVDLNKPYLSLGCSNAKLPVSMPMPIARTARQTSRTDCPADRLKFFETLRLLLKLT
SVSKKKDREQRGQENTAAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQAIPDIIN
EILTFKVNYGSAAFSRNGAGFNGTSLEGQCRTLHGTNSLGCSTYHEHLQRQRVSFEQVKR
IMELLEYMEALYPSLQALQKDYERYAAKDFEDRVQALCLWLNITKDLNQKLRIMGTVLGI
KNLSDIGWPVFEIPSPRPSKGYEPEEEGEDTEGELRELESGTEESDEERSPNPRVPELRL
SADTILDSHSQGCASRKLERLESEEDSVGWGIADCGPEASRHCLTSIYRPFVDKALKQMG
LRKLILRLHKLMNGSLQRARVALVKDDRPVEFSDFPGPMWGSDYVQLSGTPPSSEQKCSA
VSWEELRAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQVYFDYMRS
WIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLD
SGLQESCAELWISADDNGAADELRRSVIEISRALKELFHEARERASKALGFAKMLRKDLE
IAAEFVLSASARELLDVLRAKQYVKVQIPGLENLHVFVPDSLAEEKKIILQLLNAATGKD
CSKDPDDVFVDAFLLLTKHGDRARDSEDGWSTWEARAIKIVPQVETVDTLRSMQVDNLLL
VVMESAHLVLQRKAFQQSIEGLMTVHHEQTSSQPVIAKALQQLKNDALELCNRISDAIDR
VDHMFTLELDAEVEESESATLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYI
SFAQKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIG
HVIGKPHSPVTAIHRNSPRPVKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAE
LQFRSLSRHSSPTEERDEPAYPRSDSSGSTRRSWELRTLISQTKDSASKQGPIEAIQKSV
RLFEERRYREMRRKNIIGQVCDTPKSYDNIMHVGLRKVTFKWQRGNKIGEGQYGKVYTCI
SVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEY
CDEGTLEEVSRLGLQEHVIRLYSKQITVAINVLHEHGIVHRDIKGANIFLTSSGLIKLGD
FGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTG
KRPWHEFEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKIRWTASQLLDHAFV
KVCTDEE
NT seq 4164 nt   +upstreamnt  +downstreamnt
atgaacacaccgagtcagtctccacataaagacttggggaagggagtggaggccgtggag
gagtacagctacaagcaggggaagaagacgcgagcgactctgaggacaacagagcgagac
cataagaaaaatgcacagtgctcgttcatgttggactcagtggccgggtctttgccaaaa
aaatctattccagatgtggatctcaataagccttacctcagcctcggctgtagcaacgcc
aagctgccagtctctatgcccatgcctatagccagaactgcgcggcagacttcccggacg
gactgcccagcggatcggttaaagttctttgaaacactgcgccttttgctaaagcttacc
tcagtctcgaagaagaaggacagggaacagaggggacaggaaaacacggctgctttctgg
ttcaaccggtcaaatgaactgatctggttagagctccaggcctggcacgcaggccgcacc
atcaatgaccaggacctctttttatacacagcccgccaagccatcccagatattatcaat
gaaatcctcacattcaaagttaattatggaagcgctgccttctctagaaatggagctggt
ttcaacggtacctcgctagaaggtcagtgcagaacccttcatgggacgaacagtctaggc
tgttcaacctaccacgagcacctccagcgccagagggtctcatttgagcaggtgaaacgg
ataatggagctgctagagtacatggaagcactttatccgtccttgcaggctctgcagaag
gactacgagagatacgccgcaaaggactttgaggacagagtgcaggcactctgcctgtgg
ctaaacatcacgaaagatttaaatcagaagttgaggattatgggcactgttctgggcatc
aagaacttatcagacattggctggccagtgtttgaaatcccttcccctcggccatccaaa
ggctacgagcctgaggaggagggcgaggacacagagggagagctgagggagctggagagt
gggacggaggagagtgatgaggagcgaagtcccaatccgagggtgccagagctcaggctg
tctgccgacaccatcttggacagtcactcccagggctgcgcgtccaggaaacttgagagg
ctcgagtccgaggaggactctgtaggctgggggatagcagactgtggtcccgaagccagt
aggcattgtttgacttctatctatagaccgttcgtggacaaagcactgaagcaaatgggg
ctgaggaagttaattttacgacttcataagctaatgaatggctccttgcaaagggctcgt
gtagctctggtaaaggatgaccgtcctgtggagttctctgactttccaggtcccatgtgg
ggctcggattatgtgcagttgtcggggacgcctccttcctcggagcagaagtgcagtgct
gtgtcctgggaagagctgagggccatggacctgccctcctttgagcccgccttcctggtg
ctctgccgggtcctgctgaacgtgatccatgagtgcctgaagctgcggctggaacagagg
ccggccggggagccttccctcttgagtatcaagcaggtgtattttgactacatgagaagc
tggatccaaatgctacagcagttacctcaggcttcccatagcttaaaaaacctgctagaa
gaagaatggaatttcaccaaagaaataacccattacatccggggaggagaagcacaggct
ggaaagcttttctgtgacattgcagggatgctgctgaaatccacggggagctttctggac
tctggcctacaggagagctgtgctgaactgtggatcagcgccgacgacaacggtgctgcc
gacgagctaaggaggtctgtcatcgagatcagccgagcactcaaggagctcttccatgag
gcccgggaaagagcctccaaggccctgggctttgctaaaatgctgaggaaggacctagaa
atagcagcagagtttgttctgtctgcgtctgcccgagagctcctagacgttctgagagca
aagcagtatgttaaggtacagattcctgggctagagaatttgcacgtgtttgtccccgac
agcctcgctgaggagaagaaaattattttgcagctactcaatgctgccacaggaaaggac
tgctcaaaggatccggacgacgtctttgtggatgccttcctgctcctgaccaagcatggg
gaccgagcccgtgactcagaagatggctggagcacatgggaagcacgagctatcaaaatt
gtgcctcaggtggagaccgtggacaccctgagaagcatgcaggtggacaaccttctgctg
gttgtcatggagtctgctcacctcgtacttcagagaaaggccttccagcagtccattgag
gggctgatgactgtacaccatgagcagacatccagccagccagtcattgccaaagcttta
cagcagctaaagaacgatgcgctcgagctgtgcaacagaataagcgatgccatcgaccgc
gtggaccacatgttcacgctggagttggatgccgaggtcgaggagtccgagtcggccacg
ctgcagcagtactaccgagaggccatgattcagggctacaacttcgggtttgagtatcat
aaagaagttgttcgtttgatgtctggagaattcagacagaagataggagacaaatatata
agctttgcccagaagtggatgaattatgtgctgaccaaatgtgagagcggcagaggcaca
agacccagatgggccacccaaggttttgatttcctacaagccattgaacctgcctttatt
tcagctttaccagaagatgacttcttgagtttgcaagccctgatgaatgagtgcattggg
cacgtcataggaaagccacacagccctgtcacagctatccatcggaacagcccccgccct
gtgaaggtgccccgatgccacagtgaccctcctaaccctcacctcatcatcccaactcca
gagggattcaggggttccagcgtccctgaaaatgaccgcttggcctccatagctgcagaa
ctgcagttcaggtctctgagtcggcactcgagccccacggaagagcgagacgagccagca
tatcctcggagcgactcaagtggatcaacacggagaagctgggaacttcgaacactcatc
agccagaccaaagactcggcctctaagcaggggcccatagaggccatccagaagtcagtc
cgactgtttgaagagaggaggtatcgagagatgaggaggaagaatatcatcggtcaagtg
tgcgatacccctaagtcctatgataacatcatgcatgttggactgaggaaggtgacgttt
aagtggcaaagaggaaacaaaatcggagaagggcagtatggaaaagtgtacacctgcatc
agcgtcgacacaggggagctgatggccatgaaggagattcgatttcagcctaacgaccat
aagactatcaaggaaactgcagacgagttgaaaatatttgaaggcatcaagcaccccaac
ctggtccggtactttggtgtggagcttcacagggaagagatgtacatcttcatggagtac
tgtgatgaaggcacactagaggaggtgtcaaggctgggccttcaggagcacgtcatccgg
ttgtattccaagcagatcactgtcgccatcaacgtcctccatgagcatggcatcgttcac
cgagacatcaaaggtgccaatatcttccttacatcgtctggactaatcaaactgggagat
tttggatgctcagtgaaacttaaaaacaatgctcagaccatgcctggcgaggtgaacagc
accctagggacagcagcttacatggcccctgaagttattacccgagctaaaggagaaggc
cacggacgtgcggcagacatctggagtctggggtgcgtcgtcatagagatggtgactggc
aagcggccttggcatgagtttgaacacaactttcagattatgtacaaggtgggaatggga
cacaagccaccaatccccgaaaggttaagccctgaaggaaaggactttctctcgcactgc
ctggaaagtgacccgaagataaggtggacagccagccagctccttgaccacgcttttgtc
aaggtttgcacagatgaagagtga

DBGET integrated database retrieval system