KEGG   Rattus norvegicus (rat): 116669
Entry
116669            CDS       T01003                                 

Gene name
Vwf
Definition
(RefSeq) von Willebrand factor precursor
  KO
K03900  von Willebrand factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno05165  Human papillomavirus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    116669 (Vwf)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    116669 (Vwf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116669 (Vwf)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    116669 (Vwf)
   04611 Platelet activation
    116669 (Vwf)
   04613 Neutrophil extracellular trap formation
    116669 (Vwf)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    116669 (Vwf)
   05165 Human papillomavirus infection
    116669 (Vwf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    116669 (Vwf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    116669 (Vwf)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Others
   116669 (Vwf)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   116669 (Vwf)
SSDB
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWA_2 VWC Pacifastin_I MCR_beta_N
Other DBs
NCBI-GeneID: 116669
NCBI-ProteinID: NP_446341
RGD: 621759
Ensembl: ENSRNOG00000019689
UniProt: F1M957
Position
4
AA seq 2812 aa
MNPFGYEICLLVLALTWPGTLCTEDPRDRPSTARCSLFGDGFINTFDEAMYSFAGGCSYL
LAGDCQKRSFSILGNFQDGKRVGLSVYLGEFFDIHLFANGTVMQGDQSISMPYASKGLYV
EHEAGYYKISSEAFGFAARIDGDGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTL
TSDPYDFANSWALSSENQRCKRTSPPSTNCTSSSGDMQQAMWEQCQLLKTASVFARCHPL
VDPEPFVALCEKTLCTCVTGPECACPALLEYARTCAQEGMVLYGWADHSACRPACPAGME
YKECVSPCTRTCQSLPINEVCQQQCVDGCGCPEGELLDEDRCVQSSDCSCVHAGKRYPPG
TSLPQDCNTCICRHSLWICSNEECPGECLVTGQSHFKSFDNRHFTFSGICQYLLARDCQD
HSFSIVIETMQCADDPDAVCTRSVSVRLSALHNSLMKLKHGGGVAIDGQDVQIPFLQGDL
RIQHTVMASVRLSYGEDLQMEWDGRGRLLVKLSPIYSGKTCGLCGNYNGNKGDDFLTPAG
LVEPLVVDFGNAWKLQGDCPDLHRQHSDPCSLNPRLTRFAEEACALLTSSKFETCHHAVS
PLPYLQNCRYDVCSCADSQDCLCSAVANYAAACARKGVHIGWREPDFCALSCPQGQVYLQ
CGNSCNMTCRSLSLPDEECSEVCLEGCFCPPGLYQDERGDCVPKAQCPCYHDGELFQPAD
IFSDHHTMCYCEDGFMHCTTSGASGSLLPNIVLSSPLSHRSKRSLSCRPPMVKLVCPADN
PRAQGLECAKTCQNYDLECMSLGCVSGCLCPPGMVRHENRCVALERCPCFHQGEAYSPGD
TVKIGCNTCVCRDRRWNCTTHVCDATCSALGMAHYLTFDGLKYLFPGECQYVLVQDYCGG
SSGTFRILVGNEGCTYPSVKCKKRVTILVDGGEIELFNGEVNVKRPLKDESHFEMVESGQ
YVILLLGQGLSVVWDHRLSISVVLKYTYQEHVCGLCGNFDGIQNNDFTSSSLQVEEDPID
FGNSWKVSPQCADTRKLSLDVSLAACHNNIMKQTMVDSSCRILTSDIFQGCNRLVDPEPY
LDICIYDTCSCESIGDCSCFCDTIAAYAHVCAQHGQVVAWRKPTLCPQSCEERNVRENSY
ECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDAQDCPVCE
VAGRRLASGKKITLSPNDPQHCQNCHCDGVNLTCEACQEPGGLVVPPTDAPVSSTTPYVE
DTPEPPLHNFYCSKLLDLVFLLDGSYRLSEAEFEVLKAFVVGTMERLHISQKRIRVAVVE
YHDGSHAYLELRARKRPSELRRIASQIKYVGSQLASTSEVLKYTLFQIFGKIDRPEASRV
ILLLTASQEPQRMARYFTRYLQGFKKKKVILIPVGIGPHANLKQIRLIEKQAPENKAFLL
SGVDELEQRRDEIINYLCDLAPEAPAPTKPPQVAHITVSPGISGVSSPGPKRKSLVLDVV
FVLEASDEVGEANFNKSKEFLEEVIQRMDVSPAGTHIAVLQYSYTVNVEYTFKEAQSKED
VLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDREQAPNLVYMVTGNPASDEIRRLP
GDIQVVPIGVGSRANLQELERISRPIAPIFIQDFETLPREAPDLVLRTCCSKEGLQLPTL
PPLPDCSQPLDVVLLLDGSSSLPASSFDEMKSFAKAFISKANIGPHLTQVSVIQYGSINT
IDVPWNVAQEKAYLQSLVDLMQQEGGPSQIGNALAFAVRYVTSQIHGARPGASKAVVMII
MDTSLDSVDTAVDAARSNRVAVFPIGVGDRYDEAQLRILAGPGASSNVVKLQQVEDLLTM
VTPGNSFFHRLCSGFSGVCVDEDGNEKRPGDVWTLPDQCHTVTCLANGQTLLQSHRVNCD
HGPRPSCSNSQSPVRVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGNCSYVIFQNK
EQDLEVVLHNGACSPGAVQTCMKTIEVKHAGLSVELRSDMEMAVNGRPVLAPYVGGNMQV
SIYGAIMYEVRFTHLGHTLTFTPQNNEFQLQLSPKTFASKMYGLCGICDENGANDFTLRD
GTVTTDWKRLIQEWTVQQPGSTCQSVPEEQCPISDSSHCQVLLSASFAECHKVIAPATFH
TICQQDSCHQERVCEVIASYAHLCRTNGVCVDWRTTDFCAMSCPPSLIYNHCERGCPRYC
DGNTSFCGDHPSEGCFCPQHQVLLEGSCVPEEACTQCVGDDGVRHQFLETWVPDHQPCQI
CMCLSGRKINCTAQPCPTARAPTCGPCEVARLKQSADLCCPEYECVCDLVNCNLPPVPPC
EGGLQPTLTNPGECRPTFTCACRKEECKRVSPPSCPPHRTPTLRKTQCCDEYECTCSCVN
STLSCPLGYLASATTNDCGCTTTTCLPDKVCVHRGTVYPVGQFWEEGCDTCTCTDMEDTV
VGLRVAQCSQKPCEDSCQPGFSYVLHEGECCGKCLPSACKVAGSPRGDSLSSWKSVGSQW
AVPENPCLINECVRVEDAVFVQQRNISCPQLAVPTCPTGFQLNCETSACCPSCHCEPVEA
CLLNGTIIGPGKSVMVDLCTTCRCIVQRGAIFRFKLECRKTTCEACPVGYREEKSQSECC
GRCLPTACTIQLRGGRVMTLKQDETFQDGCDSHLCRVNERGEYIWEKRVTGCPPFDERKC
LAEGGKIVKIPGTCCDTCEEPDCKDITAKVQYIKVGDCKSEEEVDIHYCQGKCASKAVYS
IDIEDLQEQCSCCWPSSTERMRVPLLCTNGSVVHHEVINAMQCRCSPRNCGK
NT seq 8439 nt   +upstreamnt  +downstreamnt
atgaatcctttcggatatgagatctgcctgttagttctggccctcacctggccagggacc
ctctgcacagaagatcctcgtgacaggccgtcgacagcccgatgcagcctctttggggat
ggcttcatcaacactttcgatgaagccatgtacagttttgcaggaggctgcagttatctt
ctggctggggactgccagaaacgttccttctcaattctcgggaacttccaagatggcaag
agagtgggcctgtctgtgtatcttggggagttttttgacatccatttgtttgccaacggc
accgtgatgcagggggaccaaagcatctccatgccctatgcctccaagggactctatgta
gagcatgaggctgggtactacaaaatttccagtgaggccttcggctttgcggccagaatt
gacggcgacggcaacttccaagtcctgatgtcagacagacacttcaacaagacctgtggg
ctgtgtggtgacttcaacatcttcgctgaagatgactttaggacgcaggaggggaccttg
acctcagacccctacgactttgccaactcctgggccctgagtagtgagaaccagcggtgt
aaacggacatctcctcccagcactaactgcaccagctcctctggggacatgcagcaggcc
atgtgggagcagtgccagttactgaagacggcgtcggtgtttgcccgctgccaccctctg
gtggatcccgagcccttcgtggctctctgtgagaagactttgtgtacatgcgtcacgggg
ccagagtgcgcgtgtcctgctctccttgagtatgcccgaacctgtgcccaggaagggatg
gtgctgtatggctgggctgaccacagtgcctgtcgcccagcatgcccggctggcatggag
tataaggagtgtgtgtctccttgcaccagaacctgccagagcctgcctatcaatgaagtg
tgtcagcagcaatgtgtagatggctgtggctgccctgagggagagctcctggacgaagac
cgctgtgtgcagagctctgactgttcttgtgtacacgccggaaagcggtacccacctggc
acctccctccctcaagactgcaacacttgcatctgcagacacagtctctggatctgcagc
aatgaggaatgcccaggggagtgtcttgtcacaggccaatcccacttcaagagcttcgac
aacagacacttcaccttcagtggcatctgccagtacctgctggcccgggactgccaagac
cactctttctccattgtcatagagaccatgcagtgcgctgatgaccctgatgctgtctgc
acccgctcagtcagtgtgcggctgtctgccctgcacaacagcctcatgaagctgaagcac
gggggaggggtggccatcgatggtcaggatgtccagattcccttcctgcaaggtgacctc
cgtatccagcacacggtgatggcttctgtacgcctcagctatggggaggacctgcagatg
gaatgggatggccgcgggcggctactggttaagctgtccccaatctattctgggaagacc
tgtggtttgtgtgggaattacaatggcaacaagggagacgacttcctcacgccggccggc
ctggtggagcctctggtggtagactttggaaacgcctggaagcttcaaggggattgtccg
gacctgcacagacaacacagcgacccctgcagcctgaacccacgcttgaccaggtttgcg
gaggaggcttgtgcgctcctgacgtcctccaagttcgagacctgccaccatgcggtcagc
cctctgccctacctgcagaactgtcgttatgatgtttgctcctgcgctgacagccaggat
tgcctgtgtagcgcagtagctaactacgctgctgcgtgtgcccgaaaaggcgtgcacatc
gggtggcgggagccagacttctgtgctctgagctgcccacagggccaggtgtacctgcag
tgtggcaattcctgcaacatgacctgccgctccctctcccttccggatgaagaatgcagt
gaagtctgtcttgaaggctgcttctgccccccagggctctaccaggatgaaagaggggac
tgtgtgcccaaggcccagtgtccctgttaccacgacggtgagctcttccagcctgcagac
atcttctcagaccaccacaccatgtgttactgtgaagatggcttcatgcactgtaccacg
agtggtgcctcggggagcctgttgcctaacattgtcctcagcagccccttgtctcaccgc
agcaaaaggagcctctcctgtcggccacccatggtcaagttggtatgtcctgctgacaac
ccacgggctcaagggctggagtgtgctaagacgtgccagaactatgacctggaatgcatg
agtctgggctgtgtgtcaggctgcctctgtcccccaggcatggtccggcacgaaaacagg
tgtgtggccttggagcgctgtccctgcttccaccagggtgaggcgtactccccaggagat
acagtgaagatcggctgcaacacctgtgtctgccgggaccggaggtggaactgtacaacc
cacgtgtgtgacgccacttgctctgcccttggtatggctcactacctcaccttcgatggt
ctcaagtacctgttccctggggagtgtcagtacgttctggtgcaggattactgtggcggt
agctctgggacctttcggatcctggtggggaatgagggttgcacttatccctcggtgaaa
tgcaagaaacgggtgaccatcctggtggatggaggggagattgaactgttcaatggagag
gtgaatgttaagagacctctgaaagatgagtctcactttgagatggtggagtcgggccag
tacgtcatcctgctgctgggtcagggcctttctgtggtctgggaccaccgcctcagcatc
tccgtggtcctgaagtacacataccaggaacacgtgtgtggcctgtgtgggaacttcgat
ggtatccagaacaatgacttcaccagcagcagccttcaggtggaggaagaccccattgac
tttgggaactcctggaaagtgagcccacagtgtgccgacacaagaaagctgtcactagac
gtttcccttgccgcctgccacaacaatatcatgaaacagacaatggtggactcatcttgc
agaatccttaccagtgacatcttccagggctgcaacaggctggtggaccccgagccatac
ctggacatctgcatttatgacacttgctcctgtgagtccatcggggactgctcctgtttc
tgtgacaccatcgctgcctatgcccacgtgtgcgcccagcatggccaggtggtagcctgg
aggaaacccacactgtgcccccagagctgtgaagaaaggaacgttcgggaaaacagctat
gagtgtgagtggcgctataacagctgtgcacccgcctgcccggtcacatgccagcaccct
gagcctctggcttgtcctgtacagtgtgtggagggctgccatgcacactgccctccaggg
aaaatcctggatgaacttctgcagacctgtgtggatgcccaagactgccctgtgtgtgag
gtggctggtcggcgcttggcttccgggaagaaaatcaccctgagtcccaatgaccctcag
cactgtcagaattgtcactgtgatggtgtgaaccttacctgtgaagcctgccaagagccc
ggaggcctggtggtacccccaacagatgccccagtcagctccaccaccccatatgttgag
gacacccccgaaccccccctgcacaacttctactgcagcaagctgctggatctcgtcttc
ctcctggatggctcctacaggctgtctgaggctgagtttgaagtgctcaaagcttttgtg
gtgggtacgatggagaggctacacatctctcagaagcgcatccgcgtggcagtggtagag
taccatgatggctcccatgcctaccttgagctcagggcccggaagcgaccctcagagctt
cggcgcatcgccagccagattaagtatgtgggcagccagttggcctctaccagtgaggtt
ttgaagtacacactgttccagatctttggcaaaattgaccgtcctgaagcctcccgtgtc
attctgctcctgaccgctagccaggagccccaacggatggctaggtatttcacccgctat
ctccaaggtttcaagaagaagaaggtcattctgatccctgtgggcattgggccgcacgcc
aacctcaaacagatccgcctcattgagaagcaggcccctgagaacaaggcctttctgctt
agtggggtggatgagctggagcagagaagagatgagataattaactacctctgtgacctt
gcccccgaggccccagcccctactaagcctccacaggtagcacacatcactgtgagccct
ggtatctctggggtttcatcaccaggacccaaaaggaagtctctggttctggatgtggtg
tttgtcctggaggcgtcagacgaagttggtgaagccaacttcaataagagcaaggagttc
ctggaggaggttatccagcgcatggatgtgagcccggctgggacgcacatcgcagttctg
cagtactcatacacagtaaacgtggagtacaccttcaaggaggcccagtccaaggaggat
gtgctgcgacatgtgcgagagatccgctaccaggggggcaacaggacaaacactgggcag
gccctgcagtacctttctgagcacagcttctctcccagccagggggaccgggagcaggca
cctaacctggtctacatggtcacggggaaccctgcctctgatgagatcaggaggttgcct
ggagacatccaggtggtacccattggggtgggctccagggccaacctgcaggaactggag
aggatcagcagacccatcgctcccatcttcatccaagactttgagacacttccccgagag
gctcccgacctggtcctgaggacgtgctgctccaaggaggggctgcagctgcccaccctc
ccccctctccctgactgcagccaacccctggatgtggtcctgctcctggatggctcctct
agcttgcctgcatcttcctttgatgagatgaagagttttgccaaagctttcatctcaaag
gccaacattgggccccatctcactcaggtgtccgtgatacaatacggaagcatcaatacc
atcgatgtaccgtggaatgtggcccaggagaaagcctatctacagagtttggtggacctc
atgcagcaggagggcggccccagccagattgggaatgctctggcctttgccgtgcgctat
gtaacttcacagatccatggagccaggcctggagcctccaaagcagtggtcatgatcatc
atggatacctccttggattcggtggacacagcagtggatgctgccagatccaaccgggtg
gcagtgttccccattggggttggggatcgatatgatgaagcccagctgaggatcttggca
ggccctggggccagctccaatgtggtaaagctccagcaagttgaagacctcctcaccatg
gtcaccccgggaaactccttcttccacagactgtgttctgggttttctggagtttgtgtg
gatgaggatgggaacgagaagaggcctggagacgtctggaccttgccagatcagtgccac
acagtgacttgcttggcaaatggtcagaccttgttgcagagtcatcgggtcaattgtgac
catggaccccggccttcatgttccaacagccagtctcccgttcgggtggaggagacctgt
ggctgccgctggacctgcccttgtgtgtgcacgggcagttccactcggcacatcgtcacc
ttcgatggacagaatttcaagcttaccggcaactgctcctacgtcatctttcaaaacaag
gagcaggacctggaagtggtcctccataatggggcctgcagccctggggccgtgcaaacc
tgcatgaagaccatcgaggttaagcatgctggcctctctgttgagctgcgcagtgacatg
gagatggcagtgaatgggagacccgtccttgccccgtacgtgggtggaaatatgcaagtc
agcatctatggtgctatcatgtatgaagtcaggttcacccatcttggtcacactctcaca
tttactccacaaaacaacgagttccaactgcagcttagccccaagacctttgcttcgaag
atgtatggtctctgtggaatctgtgacgaaaatggggccaatgacttcacattgcgagat
ggcacggtcaccacagactggaagaggcttatccaggaatggaccgtgcagcagccaggg
agcacatgccagtctgttcctgaagagcagtgtcccatctctgacagctcccactgccag
gtcctcctctcagcatcgtttgctgaatgccacaaggtcatcgctccagccacattccat
acaatctgccagcaagacagttgccaccaggagcgagtgtgtgaggtgattgcttcttac
gcccatctctgtcggactaatggagtctgtgttgattggaggacaactgacttctgtgct
atgtcatgcccaccatccctgatatataaccactgtgagcgtggctgccctcggtactgt
gatggaaacactagcttctgtggcgaccacccctcagaaggctgcttctgcccccaacac
caagtcttgctggaaggcagctgtgtccccgaagaggcctgcactcagtgtgttggggac
gatggagtccgacatcagttcctagagacctgggtcccagaccatcagccctgtcagatc
tgtatgtgcctcagtgggaggaagattaactgcactgcacagccatgtcccacagcccgg
gctcccacctgtggcccttgtgaagtggctcgtctcaagcagagtgcagacctgtgctgc
ccagagtatgagtgtgtgtgtgacctggtcaactgcaacttgccaccagtgcctccgtgt
gaaggaggactccagccaaccctgaccaaccctggagaatgcagacccacctttacctgt
gcctgcaggaaagaagagtgcaaaagagtgtccccaccctcctgcccccctcaccggaca
cccacccttcggaagacccagtgctgtgatgagtatgaatgcacttgcagctgtgtcaac
tccacgctgagctgcccacttggctacctggcctcggccaccaccaatgactgtggctgc
accacaaccacctgtctccctgacaaggtttgtgtccaccgaggcaccgtctaccctgtg
ggccagttctgggaggagggctgtgacacatgcacctgcaccgacatggaggatactgtt
gtgggcctgcgtgtggctcaatgctctcagaagccctgtgaagacagctgtcagccaggt
ttttcttatgttctccacgaaggggagtgctgtggaaagtgcctgccgtctgcttgcaag
gtggctggctcaccgaggggtgattccctctcttcctggaagagcgttgggtctcagtgg
gctgttcctgagaacccctgcctcatcaatgagtgtgtccgagtggaggacgcagtgttt
gtgcagcagaggaacatctcctgcccacagctggctgtccctacctgtcccacgggcttc
cagctgaactgtgagacctcagcatgctgtcccagctgtcactgtgagcctgtggaggcc
tgcctgctcaatggcaccatcattgggcccgggaagagtgtgatggttgacttatgcacg
acctgccgttgcattgttcagagaggagccatcttcagattcaagctggagtgcagaaag
accacctgtgaggcctgccctgtgggctatcgggaggagaagagtcagagcgaatgctgt
ggccggtgcctgcctacggcttgcactattcagctgagaggaggacgggtcatgaccctg
aagcaagatgagacattccaggatggctgtgacagtcatctgtgcagggtcaacgagaga
ggggagtacatttgggagaagagggtcacgggctgccccccattcgatgaacgcaagtgt
ctggctgaaggaggcaaaatcgtgaaaattccaggcacctgctgtgacacgtgtgaggag
cccgattgcaaagacatcacagccaaggtgcagtatatcaaagtgggagattgtaagtcg
gaagaggaagtggacattcactattgccagggaaagtgcgccagcaaagctgtgtactcc
attgacatcgaggatcttcaggaacagtgctcctgctgctggccctcaagtacagagcgc
atgcgtgtgcccttgctctgcaccaatggctcggttgtgcaccacgaggtcatcaatgcc
atgcaatgcagatgttctccccgtaattgtggcaagtga

DBGET integrated database retrieval system