KEGG   Rattus norvegicus (rat): 116673
Entry
116673            CDS       T01003                                 

Gene name
Sdc3
Definition
(RefSeq) syndecan 3
  KO
K16337  syndecan 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    116673 (Sdc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    116673 (Sdc3)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   116673 (Sdc3)
SSDB
Motif
Pfam: Syndecan
Other DBs
NCBI-GeneID: 116673
NCBI-ProteinID: NP_446345
RGD: 621486
Ensembl: ENSRNOG00000011927
UniProt: P33671 G3V9B7
Position
5q36
AA seq 442 aa
MKPGPPRRGTAQGQRVDTATHGPGARGLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLE
GSGDDDSFPDDELDDLYSGSGSGYFEQESGLETAMRFIPDIALAAPTAPAMLPTTVIQPV
DTPFEELLSEHPGPEPVTSPPLVTEVTEVVEEPSQRATTISTTTSTTAATTTGAPTMATA
PATAATTAPSTPAAPPATATTADIRTTGIQGLLPLPLTTAATAKATTPAVPSPPTTVATL
DTEAPTPRLVNTATSRPRALPRPVTTQEPEVAERSTLPLGTTAPGPTEVAQTPTPESLLT
TTQDEPEVPVSGGPSGDFELQEETTQPDTANEVVAVEGAAAKPSPPLGTLPKGARPGLGL
HDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT
LEEPKQASVTYQKPDKQEEFYA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaagcccgggccgccgcgccgcgggaccgcacaggggcagcgcgtggacaccgccacc
catgggcccggggcccgcgggttgttactgccaccgctgctgctgctgttgctggccggc
cgcgccgcgggggctcaacgctggcgcaatgagaacttcgagaggccggtggatcttgag
ggctcaggggacgacgactcatttcctgatgatgaactggatgacctctactcggggtcg
ggctctggctacttcgagcaggagtccggccttgagacagccatgcggttcattcctgac
atagccctggctgcacccaccgcacctgccatgctacccacgaccgttatccagcccgtg
gataccccgtttgaggaactcctttctgagcatcccggccccgaaccagtcaccagtccc
ccactggtgacagaggtgacagaagttgtagaagagcccagtcagagagccaccactatc
tccaccaccacatctaccactgcagccaccaccacaggggccccaactatggccacagca
cctgctacagcagccaccactgcccctagcactcccgcggcaccccctgccacggccacc
acggctgacataaggaccaccggcatacaagggctgctgcctcttcccctgaccacggct
gccacagccaaggccactaccccagcagtaccctcaccacccactactgtggctaccttg
gacacagaggccccgacacctaggctggtcaacacagctacctctcggccacgagccctt
cctcggccagtcaccacccaggagcctgaagttgctgagaggagtaccctgccgttgggg
accaccgctcctggacccacagaggtggctcagaccccaactccagagtcccttctgacc
acgacccaggatgagccagaggtgccagtaagcggggggcccagcggggactttgagctg
caagaagagaccacacagccagacacagccaatgaagtggtggcggtggaaggagccgcg
gccaagccatcacctccactggggacactacccaagggtgcccgcccaggccttggcctc
cacgacaatgccatcgactcgggcagctctgctgcccagctccctcagaagagcatacta
gagcggaaggaggtgctcgtagctgtgatcgtaggtggcgtggtgggcgccctcttcgct
gccttcctggtcacgttgctcatctaccgcatgaagaagaaggacgaaggcagctacacc
ttggaagagcccaagcaggcaagcgtcacataccagaagcccgacaagcaggaggagttc
tatgcttag

DBGET integrated database retrieval system