KEGG   Rattus norvegicus (rat): 116674
Entry
116674            CDS       T01003                                 

Gene name
Jdp2, Jundm2, Jundp2
Definition
(RefSeq) Jun dimerization protein 2
  KO
K09033  jun dimerization protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    116674 (Jdp2)
   03036 Chromosome and associated proteins [BR:rno03036]
    116674 (Jdp2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    116674 (Jdp2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     116674 (Jdp2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin
Other DBs
NCBI-GeneID: 116674
NCBI-ProteinID: NP_446346
RGD: 621611
Ensembl: ENSRNOG00000008224
UniProt: Q78E65
Position
6q31
AA seq 163 aa
MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKR
PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE
LKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatgcctgggcagatcccagacccttcagtgaccgcaggctctctgccagggctcggc
cccctcaccggacttcccagctctgctctgaccacagaggagctgaaatacgctgacatc
cgcaacattggggcgatgattgcgcccttgcacttcctggaggtgaaactgggcaagagg
ccccaacccgtgaagagtgagctagatgaggaagaagagcgaaggaaaaggcgccgggag
aagaacaaagttgctgcagccagatgccggaacaagaagaaggagcgcacggagttcctg
cagagggagtcagagaggctggagctcatgaacgcagagctaaagacccagatagaggag
ctgaagcttgagaggcagcagctgatcctgatgctcaaccgccaccggcccacctgtatc
gtgcgtacagacagcgtcaggacgccggagtcggaaggcaacccgctgctggagcagctg
gacaagaagtga

DBGET integrated database retrieval system